Tags

-f-14-new-swordchef-udk-udk-114-udk-a44-07-udk-f-105-us-ch-204-us-ch-224-us-f-2010042c0110ivssh01bo222dam01bo223dam01bo297dam01bo739dam01mb946dam0212d1-781-of-a-kind10-pcs100mm1023d11024a41050ann10tipd10zpgyd110084dam110129dam110144dam110150dam110190dam110239dam110617dam110618dam110715dam110db110dm110oz110th110v110x1990111104dam111621dam111d112021dam112022dam112032dam112116dam112123dam112545dam1132015dam1132018dam117477dam119-pcs11tipd12damascus130mm131a13sn140147dam14231d1600dambk1620damckt162d1660dam1660dambk1660damckt1660dnbb1670blkdam1670nbdam16oz171d175damascus175mm1760dam1776grydam1802gd-bk1802gdbk1802gdgn1812grydam1815gdgy1817gsd-bk1821gdbk1821gsdbk1821gsdgn1839gdcf1839gsd-odg1840dam1840damckt1841g-tdb1841g-tdp1850inch1870oldam19010cds219010cds31990s19inch1db0072-342-582-782-blade20-202003ds120cm2103ds3220mm238damascus241-dd-1241-dr-1kp25in27-32riz3-143-783-91630-titanium30blade30damascus30th312-dsd32blade33damascus3488d234oz35''damascus35-titanium35blade35in35th35titanium361dsd36damascus36oz36titanium375''38damascus396-mck3damascus4-1840damascus40pc40th413''damascus440c45''45ozair46''470-131475'47ozair485-151485-1714blood50ozair51405l52-pcs525db52ozair535gry-155-040758hrc5damascus5hgk6002cfo6002cfo-11d6002cfo-14d604ds604dst60hrc60th6102-12d6102cfo-11d6102cfo-12d6165dam61hrc6265d62hrc63nf65''6516e67-layer6al4v710-144710ds72oz7500dam757-1517777dam7suchat7william803ds3803k-18805z-8bc80mm814ds816e-28210dmn8210dst8800d-ce8800d-mn8800d-mop8800dcb8800dmn8800dul8amna8pg2903ds2903ds3904ds3908-161911ds95mma-work-of-arta03-pa0459a0459clonea5964tiblabaloneabcaaboinaaccordingaconditionacrylicaf-3africaafricanahadairkatak601alabamaalanalaskaalecallenalloyaluminiumaluminumaluminumwoodamaizingamazingamberamboinaambooamboynaamericanamethystamnaanaxancientandersonandreandyangeloangledanimalankromanlterannivanniversaryannualanodisedanodizedanonimusansoanthroposantiqueantlerantlersantonao3-pappalachianarbolitoarchaeoarchitecharcitechargentariaarizonaarmorarmyarnoarrakisarrivedarrowart-arthurartisanartisonartsarvenisasiaassistassistedassistedplainassitedasticusatacatlanticats-34atz1802gdbkatz1815gdbkatz1815gdgyatz1815gsdbkaubracauthor'sauthorizedauthorshipautoautomaticavailableawesomeaxesaxisayckayothayaazraelaztecb-12b-udk-ck-40b04-wmmcb05-mctb10darkbackbacknobackpocketbaconbadlandsbakedbaklashbalbachbalbachdamastbalibalisongballballsbamboobancheebanterbareknuckbareknucklebarkbarlowbaronbarracudabarrelbarrybarsbasicbasketbasketweavebassbassmanbastionbatmanbatterfliesbattlebeadbearbearingbearingsbeastbeatsbeautifulbeautifullbeaverbeggbeginnerbeginnersbelievebeltbenchbenchmadebergambernardbertiebespokebestbestechbewarebiggestbikebiker-1biker-2billbilletbillybirchbirdsbiriukovbirthdayblackblack-lipblackbronzeblacklipblackorangeblacksmithblackwhitebladbladeblade-foldingblade-kb503blade-kb504bladedbladegraybladehandlebladesbladeworksblairblastblazerblondbloodblueblueblackbluedblurbnibbo01130bo02574bo03240bo03287bo110662dambo112116dambo84damboarboardbocotebokerbolsterbolsteredbolstersbolsters-udk-221boltboltsbondbonebonebonebonehornebonehornewoodbonestagbonewoodbonewoodhornbonewoodhorneboomerangbossboudiccaboughtbovibovinebowiebr0242bradbrancobrandbrandantbrassbreakerbrendbrendwwbrettbrianbridgebrilliantbronzebrownbrowningbrucebt2103gbt2103hbuchnerbuckbuck110sbucknbearbudgetbuffalobugoutbuildingbullbulldogbulletbullmastiffbumblebunnyburingburlburnleyburntburrbushbushcraftbushibutcherbutterflybuttonbuyerbuyersbx-8bx-8abx-8damc-tekc01cc10jbbpc10jbopc10tidc10tipdc10zpgydc113cfpdc11fpnbdc11jbbpc11jbopc11tidc11tipdc11zpgydc19010c-ds2c19010c-ds3c2004ds-1c2103ds-2c2103ds-3c211tipc234-ac41cf40thc801dsc903dsc903ds2c904ds-3c907dsc908ds-1c908ds-2c90gfblpdc914ds2ca74174cablecabochoncactuscaffreycaimancalderoncaliforniacalycamelcampcampercampingcanoecanyoncapecarboncarbonfibercardsmancarltoncarriedcarrillocarrilloairkatcarrycartercartoncarvecarvedcarvingcasecasteelcastlegatecatalinacatchingcentauricentercentofanteceramiccerfcertificationchachekachadchainchainsawchallengechamblinchaptercharliecharltonchb062cheburkovcheckeredcheetahchefchefschenchesnutchestnutchiefchimerachinachinesechinnockchiselchivechollachopperchrischronicchubbychuckchuncircacitrinecivc2002ds1civc2003ds1civc2010ds1civc2020ds1civc2024ds2civc2107ds3civc801dscivc802dscivc803dscivc902dscivc904dscivc904ds2civc904ds3civc905dscivc907dscivc908ds1civc908ds2civc914ds1civc914ds2civc917dscivivicladclamclapclarkclassclassicclassicsclassiestclaudeclawclayclaymorecleancleaningclear-lake-forgecleavercliffclintclioclipclip-udk-f-97clip-usclip-us-77closeclosedclosed6107wcoatedcobaltcobracocobococobolocoffeycoffincoinscoldcolemancollectcollectablecollectiblecollectioncollectorcollectorscolorcolorbonehornewoodcoloredcolorfulcolorscolourcombatcommemorativecommunitycompactcompanioncomparisoncompasscompletioncomplexconditionconfiscatedcongressconspiracystuffcontouredconvictcooglercookcoolcoolhandcoopercoppercopperheadcopycoralcoralnebulacorbitcorecoredcoriancorradobillcorsacostumecougarcouldncourtyardcouteaucover-udk-usa-188coverscoyotecpm-154craftcraftedcraftscraftsmancraftsmashipcranecrawfordcrestcrimsoncrococrowdercsabacunashircurrycurvacustomcustom'90customedcustomizedcustomscustoncutlerycutwalacuzrd-01d-06d-09daggerdaggers-includingdailydakedaledalibordamadamacoredamasdamascusdamascus-mokume-ivory-ctdamascus-steel-bladedamascuscocobolodamascusdamascusdamascusengraveddamascusfeatherdamascusm390damascusmammothdamascusmokumetimascusdamascusmopdamascussdamascusstagdamascustitaniumdamascusvg-10damascuswooddamaskdamastdamasteeldamastmesserdanieldarkdarreldartmouthdavedaviddavidsondavisdaysdealdealerdecepticon2decepticon2tacticaldecorateddeejodeepdeerdefcondelicadeltadeluciadeluxedepotdescriptiondesertdesigndesigneddesignsdesktopdeviantdevildevindiamonddickdickweberknivesdiegodifferencedilluviodiplomatdippolddirkdiscontinueddisplaydisplayeddividenddixondkc-101dkc-105dkc-139dkc-169dkc-312dkc-38dkc-45dkc-46dkc-591dkc-592dkc-597dkc-613dkc-614dkc-617dkc-619dkc-62-bldkc-62-wdkc-621dkc-63dkc-66dkc-67dkc-70dkc-71dkc-72dkc-726dkc-76dkc-783dkc-96dkc45dm902dmfrel-damadmtwdoctordoctor'sdolphindomastdominatordonedorolitedoubledoucettedougdownsdozormedracodragondragonskindreamcatcherdreamsdressdrifterdropdrop-pointds93xdualduaneduckdukedumchusduncandunkerleydupontdurabilitydurabledwainedwyerdyeddynastydz-5203-modz-5205-mweacheagleeasyeatonebayebonyedgeedgeseditionedwardseggerlingeickhornel02delaneldereleganceelementumelephantelevenabelijaheliteelvenemazingembretsenemissaryemotionenchantressenduraendura4engineengraveengravedengraverengravingengreavedenlanentireertilescapeespadasespecialyestateetchetchedetzlereurofighterevansexarchexcellentexclusiveexecutiveexoticexpensiveexplosionexpoexporterexpressexquisiteexskeliburextremaextremeeyesf-61f-63f-85f-supersonicf011fabulousfactoryfadefadedfakefallknivenfancyfangfastfauxfeatherfecasfeelfeistyferrumfever'fiberfiberg10fiddlebackfieldfieldsfiggyfighterfilefile-workfile-work-us-75fileingfileworkfileworkedfilletfincafinchfindfinefinishfinnishfirefirstfishfishermanfishingfivefixedfl-002flameflamedflatflickflightflipflipperflowerflytaniumfm214fm215fn79fo-2007fo-2035fo-2081foilfoldfoldefoldedfolded-forgingfolderfolderfoldingfoldersfoldingfoldingpocketfoltsfongfontenilleforceforestforgeforgedforgingforsetifossilfossilizedfossilsfox-1fox521dbrfox521dlbfraleyframeframelockframesfrancefrankfranklinfredfreefreemanfrenchfrictionfridayfriedlyfriezefrontfrontierfs13cbc-2fs13cbd-5fs296z-2fs298z-1fs301f-2fs307z-1fs318z-2fs321z-2fs324z-2fs478b-5fukutafullfullyfusionfx-521dlbg-10g10cfg10titaniumgallaghergarnetgategb1039gb1099gb1129gb1160gb1161gb1162gb1164gb1167gb1179gb1180gb1241gb1244gb1245gb1250gb1268gb1396gb1581gb329gdt035gearbestgearheadgearldgedraitisgeminigentgent'sgentacgentlemangentleman'sgentlemensgenuinegeorgegermangermanygettinggeweihgiftgiftsgilbreathgillgillesgiveawaygl-10damgloryglovesglowgo17godfathergoldgold-platedgoldengoldscrewgorgeousgorskigottagegovernorgradegrapesgrasshoppergraygray-blackgray-bonegreatgreengreenblackgreggrenadillgreygrimsmogrindgrindhousegripgripsgrizzlygrizzlybladesgroovegroovedgroundgrovergryblkguardguardianguideguillochegunshingunstockgysingeh300-dhackberryhaddockhadehadeshadlehagenhallmarkedhalloweenhammeredhanclehandhand-forgedhand-madehand-made-damascushand-pickedhandcraftedhandehandedhandelhandforgedhandlhandlehandledhandleshandletacticalhandmadhandmadehandmdehansharaharaldhardhardnesshardwoodharkinsharpoonharringtonharseyhartkopfhatthaweshawkhazakurahdc889heartstopperheathellionheltonhematitehendrixhenryherbertzherehermanherringhfd-050hh-10176hibbonshideyoshihigginshighhigh-endhighlyhigohigonokamihikarihikinghindererhippohirohistoricalhistoryhitchmoughhkbokerhoguehoneyhorizionhorizonhornhornbeamhornehornewoodhorsehostetlerhoundhourhowardhugehuge1850hummerhummingbirdhuneerhunterhunter-factoryhuntershuntinghuntingcampinghuntingcampingfishinghuntingfishinghuntingfoldingbowietrackerkarambithuntinghandmadeleatherhuntinglothuntsmanhurstieyasuiharaillusionimbulaimpactimperiumimpiimpressionsinchinchesinciteinclincludeincredibleindiaindianindustryinexpensiveinfernoinlaidinlayinlay'springinlaysinsetintegralinterestinginterframeinterlockinterruptinvestmentirbisironironwoodishamisonadeissardissueitalianitalyitemivoryivsshjackjacksjacksonvillealjadejademanjagdmesserjaguarjamesjangtanogjangtanonjangtanongjapaesejapanjapanesejaroszjasonjaygerjazzjellyjensjeremyjerryjessejewelryjiggedjk-2djnr1035jo-034jodyjoeljohnjointjointsjudyjuliejumbojunglejuniperjunkerjunker2junkojuriyjutejw416k-22k0048k0049k0128chavesk1019d1k1024a4k1024a5k1027a4k1027a6k2009a3k2009a4k201k2026bb1k3dpdcfk3tdcfk484k4blsdk4brsdkajikalfayankamikanekomakanetsunekangkanseptkarambitkasatkakasperkasumikatakirakatanakatmandukatsukb-504kb508kdm0006ke-f55keelkeithkellykershawkestrelkeychainkhalsaki3302b1kickstandkikyokilijkindkingkiouskiousjuliekirikirinitekirinite-us-ch-06kissingkitchenkizerkizlyarkknivesklappmesseklappmesserkm-102knfeknifeknife'chikiri'knife'doc'knife-dlcknife-fatknife-japaneseknife-niwbknife-vintageknife131eknifeboneknifecenterknifedamascusknifedyedknifehandmadefinishknifehornknifeknivesknifelinerknifemadeknifemakerknifemakingknifereadyknifesknifestyleknifeworksknigeknightknivekniveskniveslimitedkniveslockkniveslotknockoutkojikolourkonrokukratoskriegarkrisks1660damkubeykukrikuliskungfukusumikwaikenkyoceral01dl21-1056l31-1005l31-1410l31-1414labellaconicoladderladyladyalagenlagerlaguiolelaminatelancetlapislargelarimarlatelaunchlayerlayeredlayerslazulilc10900lc11500lc22550le006le801z-2leaderleafleatherleaveleavesleekleftlegacylegionarylengthleninleo-damastleopardleroylesnichiyleverlevineleyasulibertylifelightfootlightninglightspeedlillelillielimitedlinderlinearlinelocklinerliner-locklinerlocklinerslinklinnerlocklionlionsteellittlelizardlk5015dlmc-1204dloadedlobolochsalocklock-backlock-ch-35lockbacklockcs-137lockcs-149lockcs-151lockcs-160lockcs-181lockinglockudk-a227-19loganlombardlondonerlonelonglongshiplongworthlooklordlotslottlouislouisianaloydlozadalso1-dlst8800dmnlst8800dullt-01lubeluciferluminouslunaslutavoyluvthemknivesluxurym01mb739damm250m390macassarmacawmachetemachinemackrillmacustamaddmademagmamagnummahoganymahogonymajesticmakemakermakersmakhamakingmamamammothmaniagomantismanualmanufakturmaplemarblemarblesmarfionemarkmarkermarkusmarlinmarshmarshalmarshallmartinmarymassaromastadonmastedonmastermasterpiecemastodonmaterialmaterialsmatrixmattemaxwellmaxxmayomc-0010dmc-0012dmc-0013dmc-0014drmc-0019dmc-0022dmc-0023dmc-0031dmc-0036dmc-0052dmc-0073dmc-0074dmc-0076dmc-0092dmc-0111dmc-0112dmc-0114bdmc-0121dmc-0122drmc-0145rmc-0146mc-016mc-0161dmc-0164dmc-10dmc-111dmc-112dmc-113dmc-114dmc-121dmc-122drmc-123dmc-125dmc-126dmc-126gmc-13dmc-14dmc-15dmc-163dmc-164-dmc-164dmc-16dmc-17dmc-181dmc-182dmc-183dmc-184dmc-185dmc-18dmc-2mc-202mc-211dmc-212dmc-213dmc-22dmc-25dmc-26dmc-3mc-31dmc-32dmc-33dmc-34dmc-35dmc-36dmc-37cmc-37dmc-52dmc-53dmc-53drmc-54drmc-7mc-71drmc-72dmc-73dmc-74dmc-74dimc-74drmc-75dmc-76dmc-76dimc-76dpmc-77dmc-77dimc-77drmc-78dmc-79dmc-79dpmc0041cmc0114bdmc0161dmc124dmc161dmc163dmccluremcconnellmchenrymckennamcu-mc31dmcu114dmcu121dmcu122drmcu123dmcu124dmcu12dmcu14dmcu15dmcu161dmcu162dmcu181dmcu183dmcu184dmcu23dmcu31dmcu33dmcu37cmcu41cmcu71dmcu73dmcu79dmcustameatmeatcraftermechanismsmedievalmediterraneanmediummegamelvinmen'smercatormercurymerlinmessermetalmeteoritemeteroritemexicanmexicomeyermicartamicarta-udk-223micartamothermichaelmickmicromicrotechmidlandmikemike'whiskers'mikimikkelmikovmilanomillionmillitminimini-bmini-gminiatureminiblueminsmintmintnewmintyminutesmiragemirrormistakemiyamotomkm-maniagomkmfl01-dmkmfl02-dmna-1022mnandimochamodelmodeledmodelsmoellermohibmokimokumemokumeblackmokutimolarmollettamonarchmongoosemonkeymonthsmoonmoosemosaicmosiacmostmothermotosukemoverms-167ms-2241ms-3737ms-4901ms-4915muelamullermultimusakamusashimuskratmustmustangmycartamysterynagaonajanakirinaminapanativenaturalnaturenauticalnavajanavajonavynbtcsdkrbgnealnecknecklacenedfossnevernevlingnewbeautifulnewootznicenichenicholsnicknickelnicklenifenightnightforcedamascusnighthawknightmarenini'sninjanironishijinnishjinnkvdnoahnoblenobunaganorrisnorthnottnovabladesnowlandnr20numbernumberednutsnwfcsdkrtgoceanodinoodiumofferoistrichok4foliveolivewoodolsonone-handone-of-a-kindonehandoniononlyopenopeningoperaopnerorangeorcaorianoriginalorthodoxortisorvisosborneosograndeknivesospreyotter-messeroutdooroutdoorsoverallovereynderoverviewp01bo101damp01bo297damp01bo511damp01bo739dampacificpadaukpaintpaintedpakistanpakkapakkawoodpalmpanesepanicpantherpaperpaperspaperworkparaparagonparangpardueparkerparker-edwardsparrotpartpassionpataudpatenpatternpatternedpattrenpattrencustompauapaulpb-176pb-178pc38peachpeacockpeakpealpearpearlpeasepeelpenapenguinpeopleperalperfectperfectoperforatedperkinperridotpersianpersistencepeterpetitphilippinesphoenixphotospickpiecepiecespikattipikepimppinkpinkdamascuspinspintailpistolpitbosspivotpk01224pk01227pk01229pk01246pk01253pk01300pk01302pk01305pk01306pk01309pk01310pk01311pk01312pk02132pk02136pk05013pk05014pk05021pk05022pk05023pk05024pk05025pk08009plagueplainplainedgeplanetplatanplateplatedplatingplethirospmpspbkmdmpmpspgrmdmpocketpocketfoldingpocketknifepohlpointpolishpolishedpolkapolypolygonalpondpoosiripopcornpoplarpopularpoputchikpostpouchpowderpowerprattpraxispre-benchmadepredatorpremiumprepperspresentpresentationprestigepretatoutpreviewpreypricedprimeprincepristinepro-techproblemprocessproductionproponentprotechprotoprototypepullerpumapunisherpurchasepurduepurplepuukkopythonqingqs131-aqsp131-equalityquantumquestquickquincequincewoodr1123-dr1173-dr1303-dr2065r2sg2raindopraindropraindrprainyrajputknivesralphram'sramboranchrancherrandallrandomrarerare-remingtonraskratioravenrazorrc04rc05rc06rc12rc15rea010rea019rea09readreadyreak4sdrealreaterebarreceivedreciperedwoodreesereevereevesrehmanreifreleaseremerremingtonrepeatedlyrepublicrescueresinretailersreticulanretiredreturnedreviewreviewsrhinorickrietveldrifflerightrikerikyuriserrk-4061rk-4283rk-4284robertrobinsonrockrockeyerocksteadrogerrollroninroosterrootroserosethrosewoodrotoblockroxstarrubbedrubbercopperrudolphruplerussellrussiarussianrusskiyrusslockrustedrusticrustys35vns45vns90vsabersajisakaisalesallysaloonsalvationsambarsamiersamiorsamuraisan-misandsandalwoodsanderssandlewoodsantasantokusapphiresapphiressatinsavagesayascalescalesscallionscarabscaryschradeschwartzschwarzerscorpionscottscoutscrewscrewsscrimscrimshawscrubbersculptedsculptureseahorsesealseasonsebenzasecondsseedseensekiseki-japansellsellerserialseriesshabazzshadowshallotshamwarisharsharksharpsharpedsharpensharpeningsharpestshawshealthsheatsheathsheathboxsheathssheepsheetshellshermanshiffershikarishinshinrashipshippingshirasayashirogorovshoeshogunshootoutshopshortshouldshowshredshreddedshunshurapsiberiansiccarisicilysidesidekicksides-damascus-foldingsigilsignaturesignedsilversilverbonesilverdamascussimeonsimonssimplesinghsinglesisterssixleafsizeskinskinnerskinningskullskyfallskylinesl-04slabslashsleeperslimslimlineslipslip-jointslipjointsmallsmallestsmithsmkesmoothsnakesnakeskinsnakewoodsnakewoodtitaniumsnipersnowsolesolisolidsolingensolosongsonssouthsouthernspainspaltedspanspanishspartanspearspearpointspecialspectrespeedsafespg2spidersportsspringsprintsprucespydercospyderospydiechef-titanium-lc200n-folding-pocket-knife-lsq6078841squiresr-1sr-2sr1drsr2drsr2drgssctstabstabilizedstagstagantlerstagestainlessstaminastaminawoodstarstarozhilstarsstartstauersteaksteamsteelsteelcraftsteelesteellotsteelpocketsteelssteeltitaniumsteiersteigerwaltsterilesterkhsterlingstevestevenstickstidhamstilettostingraystockstockmanstonestonesstonewashstoneworksstoneworks-mammothstormstraightstraightbackstrazh-2strelitstretchstriderstripestripedstrizhstrykerstubbystückstudstunningstylesuchatsuchat-custom-folding-knife-damascus-steel-engraving-black-pearl-dragon-art-k02sullivansultansupersuperbsurvivasurvivalsvarnswaggerswanswarowskyswayswedishsweetswiftswirlswissswitchswitchbladeswordswordssynergysynergy3syntheticszilaskit-rext12-dpt1810gt2026bc1tacticaltactilitytaigatail-locktaiwanesetaketakeritakestakeshitakeshi'chikiri'talentedtalismantanbotangtanktantotarpontaschenmessertb52117tbfm214teachestechtechniquetechrontecnocuttemperedtempesttepeterrysknifestoreterzuolatestteststexturedthaithailandthankstheorythiersthitathomasthompsonthorthornthreethujathumbthumbscrewthuyati-cftiblacktiblackbluetibluetiestigertigerbambootighetimascustimavotimbertimberwolftimetinkertiretirpitztirpitz-damascustishredtispintispinetitantitaniumtitaniumcarbontitaniumcftitaniumcoraltitaniumdamascustitaniumtimascustitimascustitwilltobintoddtomahawktommytooltoolstoothtoothpicktopaztopstorrenttortoistortoisetotallytoucantourismtr-3trackertraditiontraditionaltrailtrailblazertrailingtransitiontrapertrappertrapperlocktraveltredbgytredfgytreetreebrandtrendytriggertrouttroutmants1drts1dsbmts1dsgmtsubatsuchitu-untuliptunaturkeyturnbullturningturquoiseturtletusk-bothtuxedotwisttwistfulltwosuntypetyphoonu0026u0026w609u125du126du127dud-0031udk-01udk-f-101uk-699uk-701uk-719ultraum-4851umboxingunboxingunfoldinguniqueunusedunusualupdatedurbanusa-greenusa-pb-266-busa-pb-267-busa-pb-270-busedussrutilityva5840cbva5840fcva5964tiblvagabondvalachovicvaletvalleyvanhoyvariantvaryag-2vegasveinvelociraptorvelvet-linedvendettaversesveryvespertiliovg-10vg-10spydvg-10vg-2vg10vicarvictorianvictorinoxvideoviewviewsvikingvillersvilliersvintagevioletblueviperviragovk0022vk0067vk8136vlogvojkovorsmavoyagerw1759wakizashiwalkwalkerwalnutwalruswalterwarenskiwarrenwarriorwashwasherswaterfallwatsonwavewayneweaveweberwedgeweekenderweilandweinmuellerweirdestwengewerewesternwesthuizenwharncliffwharncliffewheelerwherewhiplashwhiskerswhitakerwhitewhittakerwhittlerwholesalewidderwifewildwilliamwilliamswillumsenwilsonwiltonwinewinklerwinstonwinterwirewith3with325with35with4withbackwithbluewithbrasswithbronzewithcustomwithdamascuswithengravedwithfilewithfinewithleatherwithlinerwithlockwithmammothwithpocketwithquincewoodwithserialwithsheathwithstagewithtwithtrackwizardwolfwoodwoodenwoodhornewoodswoollywoolyworkworkedworkshopworldwornwu-shuwyvernx-seriesy-startyearyearsyellowyellowhorseyoroiyoshiyukikazezadirazatorizdp-189zdp189zebrazelanciozermattzingzinkerzipperedzirczirconiumzomezorianzukuri

Categories

Flickr Photogallery

Subscribe Newsletter

subscribe with FeedBurner

Handmade Folding knife. David Winston. Frontier Style Damascus Stag

  • September 16, 2020 at 10:34 am
Handmade-Folding-knife-David-Winston-Frontier-Style-Damascus-Stag-01-gkxo
Handmade Folding knife. David Winston. Frontier Style Damascus Stag
Handmade Folding knife. David Winston. Frontier Style Damascus Stag
Handmade Folding knife. David Winston. Frontier Style Damascus Stag
Handmade Folding knife. David Winston. Frontier Style Damascus Stag
Handmade Folding knife. David Winston. Frontier Style Damascus Stag
Handmade Folding knife. David Winston. Frontier Style Damascus Stag
Handmade Folding knife. David Winston. Frontier Style Damascus Stag
Handmade Folding knife. David Winston. Frontier Style Damascus Stag
Handmade Folding knife. David Winston. Frontier Style Damascus Stag
Handmade Folding knife. David Winston. Frontier Style Damascus Stag
Handmade Folding knife. David Winston. Frontier Style Damascus Stag
Handmade Folding knife. David Winston. Frontier Style Damascus Stag

Handmade Folding knife. David Winston. Frontier Style Damascus Stag
Handmade thumb friction frontier style Damascus and stag folder from David Winston. The blade is Damascus with file work on the spine and on the blade extension that’s used for opening and holding the blade open. Scales are stag with no chips or cracks except for one natural void area on the bottom of one scale that shows in the photos. The Damascus back bar is also file worked and has a twisted extension at the butt. It comes in a new zippered case Streaks and smudges are fingerprints and polish residue. Shadows and bubbles are from the camera. Ships to 50 states only. The item “Handmade Folding knife. David Winston. Frontier Style Damascus Stag” is in sale since Tuesday, September 15, 2020. This item is in the category “Collectibles\Knives, Swords & Blades\Collectible Folding Knives\Modern Folding Knives\Custom & Handmade”. The seller is “gargisse” and is located in Ione, California. This item can be shipped to United States, Canada, United Kingdom, Denmark, Romania, Slovakia, Bulgaria, Czech republic, Finland, Hungary, Latvia, Lithuania, Malta, Estonia, Australia, Greece, Portugal, Cyprus, Slovenia, China, Sweden, South Korea, Taiwan, South africa, Thailand, Belgium, France, Hong Kong, Ireland, Netherlands, Poland, Spain, Italy, Germany, Austria, Bahamas, Israel, Mexico, New Zealand, Singapore, Norway, Qatar, Kuwait, Bahrain, Croatia, Malaysia, Colombia, Costa rica, Dominican republic, Panama, Trinidad and tobago, Guatemala, Honduras, Antigua and barbuda, Aruba, Belize, Dominica, Grenada, Saint kitts and nevis, Saint lucia, Montserrat, Turks and caicos islands, Barbados, Bangladesh, Bermuda, Brunei darussalam, Bolivia, Egypt, French guiana, Guernsey, Gibraltar, Guadeloupe, Iceland, Jersey, Jordan, Cambodia, Cayman islands, Liechtenstein, Sri lanka, Luxembourg, Monaco, Macao, Martinique, Maldives, Nicaragua, Oman, Pakistan, Paraguay, Reunion, Uruguay, Russian federation.
  • Handmade: Yes
  • Modified Item: No
  • Country/Region of Manufacture: United States
  • Blade Material: Damascus Steel
  • Lock Type: Thumb Friction
  • Blade Type: Drop Point
  • Blade Edge: Plain
  • Original/Reproduction: Original
  • Type: Folder
  • Year: Current
  • Number of Blades: 1
  • Opening Mechanism: Manual
  • Handle Material: Stag
  • Brand: David Winston

Handmade Folding knife. David Winston. Frontier Style Damascus Stag