Tags

-f-14-mintpre-owned-new-set-15-swordchef-udk-udk-04-udk-1-udk-110-udk-114-udk-20-udk-3-udk-4-udk-5-udk-7-udk-a187-13-udk-a44-07-udk-f-105-us-100-us-103-us-109-us-71-us-98-us-ch-155-us-ch-198-us-ch-200-us-ch-204-us-ch-224-us-f-2010042c0110ivssh01bo222dam01bo223dam01bo297dam01bo478dam01bo739dam01bo909dam01mb739dam01mb946dam0212d1-781-of-a-kind10-pcs100-pcs100mm100pcs100x1023d11024a41050ann10pcs10tipd10withcoa10zpgyd11''110084dam110129dam110144dam110150dam110190dam110237dam110239dam110617dam110618dam110715dam110db110dm110oz110th110v110x1990111101dam111103dam111104dam111621dam111d112021dam112022dam112032dam112116dam112123dam112545dam1132015dam1132018dam117477dam119-pcs11tipd12-pcs12damascus130mm131-e131-q131-s131a135-085213sn140147dam14231d15-pcs15pc1600dambk1620damckt162d1660cfdam1660dam1660dambk1660damckt1660dnbb1670blkdam1670nbdam16oz17-pcs171d175damascus175mm1760dam1776grydam1802gd-bk1802gdbk1802gdgn1812grydam1815gdgy1817gsd-bk1821gdbk1821gsdbk1821gsdgn1839gdcf1839gsd-odg1840dam1840damckt1841g-tdb1841g-tdp1850inch1870oldam18th1900s19010cds219010cds31990s19inch1db0071foh2-342-582-782-blade20-2020-pcs2003ds120cm20th2103ds321st220mm238damascus24-pcs241-dd-1241-dr-1kp2445dam24damascus25-pcs25in25pcs26damascus27-327damascus27th2riz3-143-783-91630-titanium30blade30damascus30th312-dsd31blade32blade32damascus33-titanium33damascus34-titanium3488d234damascus34oz34titanium35''damascus35-titanium35blade35in35th35titanium361dsd36damascus36oz36titanium375''37in37titanium38damascus38in396-mck39damascus39titanium3damascus3pcs3piece4-1840damascus40pc40th413''damascus440c45''45ozair46''470-131475'47ozair485-151485-1714blood4pcs50ozair50pc51405l52-pcs52100nickel525db52ozair535bk-2535gry-155-040758hrc5custom5damascus5hgk6-pcs6002cfo6002cfo-11d6002cfo-14d604ds604dst60hrc60th6102-12d6102cfo-11d6102cfo-12d6165dam61hrc6265d62hrc63nf65''6516e67-layer6ai4v6al4v710-144710ds72oz7500dam757-1517777dam7pcs7suchat7william8-pcs803ds3803k-18805z-8bc80mm814ds816e-28210dmn8210dst8800d8800d-ce8800d-mn8800d-mop8800dcb8800dmn8800dul8amna8inches8pcs8pg2900p8903ds2903ds3904ds3908-161911ds929p95mma-work-of-arta03-pa0459a0459clonea2927a2936a2946a2968a2980a4716a4800a5964tiblabaloneabcaabgenutztenaboinaabsolutelyaccordingacidaconditionacrylicactuallyadmitsaf-3affordablyafricaafricanafsaagateahadaircraftairkataishatechak601al-adb164alabamaalanalaskaalbacetealbatrossalecallenalligatoralloyalmostalumaluminiumaluminumaluminumwoodalvelyamaizingamazingamazonamberamboinaambooamboynaamericanamethystamiriteamnaanaxancientandersonandreandyangeloangledanimalankromanlterannivanniversaryannualanodisedanodizedanodizedoveanondizedanonimusansoantelopeanthroposantiantiqueantlerantlersantonantonioao3-papartappalachianaprilarbolitoarchaeoarchitecharcitecharcusargentariaarizonaarmorarmyarnoarrakisarrivedarrowart-arthurartisanartisonartistartsarvenisasiaasm7323asmrassemblyassistassistedassistedplainassitedasticusastronautat-1210atacatlanticats-34attemptingatz1802gdbkatz1815gdbkatz1815gdgyatz1815gsdbkaubeyaubracauthor'sauthorizedauthorshipautoautomaticavailableawesomeaxesaxisayckayothayaazraelaztecb-12b-udk-ck-36b-udk-ck-40b04-wmmcb05-mctb10darkbackbacklockbacknobackpocketbaconbadlandsbailoutbakedbaklashbakubalbachbalbachdamastbalibalisongballballsbamboobancheebandbanderasbankbanneretbanterbareknuckbareknucklebarkbarlowbaronbarracudabarrelbarrybarsbasicbasketbasketweavebassbassmanbastionbatmanbatterfliesbattlebb14bb15beadbearbearinbearingbearingsbeastbeatsbeautifulbeautifullbeaverbeggbeginnerbeginnersbegleiterbeingbelievebeltbenchbenchmadebergambernardbertiebespokebestbestechbetterbewarebidenbiggestbikebiker-1biker-2bikersbillbilletbillybiorkman'sbirchbirdsbiriukovbirthdayblackblack-lipblackblueblackbronzeblacklipblackorangeblacksmithblacksmithingblackwhitebladbladeblade-foldingblade-kb503blade-kb504bladebolsterbladedbladegraybladehandlebladesbladeshowbladeshow2023bladesmithbladesmithingbladesmithsbladeworksblairblastblastedblazerblondbloodblueblueblackbluedblurbnb3340dbnibbo01130bo02574bo03240bo03287bo110662dambo112116dambo84damboarboardbocotebohrernbokerboldbolsterbolsteredbolstersbolsters-cd-142bolsters-udk-221bolsters-udk-f-76boltboltsbondbonebone-a05-05bone-f-23bone-us-ch-111bonebonebonehornebonehornewoodbonestagbonewoodbonewoodhornbonewoodhorneboomerangbootbosebossboudiccaboughtbovibovinebowieboyfriendbr0242bradbrancobrandbrandantbrasbrassbrazenbreakerbrendbrendwwbrettbrianbridgebriefingbrilliantbrittonbrokebronzebrownbrowningbrucebt2102gbt2103gbt2103hbt2103ibuchnerbuckbuck110sbucknbearbudgetbudk-a194-20buffalobugoutbuildbuildingbuiltbulkbullbulldogbulletbullmastiffbumblebunchbunhichibunkabunnyburgundyburingburlburlwoodburnleyburnsburntburrbuschbushbushcrafbushcraftbushibusinessbutcherbutterflybuttonbuyerbuyersbx-8bx-8abx-8dambyrnac-390c-tekc01cc10jbbpc10jbopc10tidc10tipdc10zpgydc113cfpdc11fpnbdc11jbbpc11jbopc11tidc11tipdc11zpgydc19010c-ds2c19010c-ds3c19010c-ds4c20011-ds1c20040d-ds1c20041b-ds1c2004ds-1c20063b-ds1c20075a-ds1c20075b-ds1c20075d-ds1c2015ds-1c2024ds-1c2102dsc2103ds-2c2103ds-3c211tipc22025b-ds1c22036-ds2c23028-ds1c234-ac41cf40thc801dsc803ds-3c903dsc903ds2c904ds-3c907dsc908ds-1c908ds-2c90gfblpdc914ds2ca74174cablecabochoncachetcactuscadmuscaffreycaimancalderoncaliforniacalligraphycalycamarocamelcamocampcampercampingcanarycanistercannoncanoecanyoncapecarboncarbonfibercardboardcardsmancarltoncarriedcarrillocarrilloairkatcarrycartercartoncarvecarvedcarvingcasecase-damascuscasteelcastlegatecataclystcatalinacatchingcentauricentercentofanteceramiccerfcertificationcf-elitech-51ch-54ch-57ch-75chachekachadchainchainsawchallengechamblinchaptercharliecharltonchb062cheapcheburkovcheckeredcheckingcheetahchefchefschenchesnutchesterchestnutchevalierchiefchimerachinachinesechinnockchiselchivechollachopperchoppingchrischristianitychronicchubbychuckchuncircacitrinecitycivc2002ds1civc2003ds1civc2010ds1civc2020ds1civc2024ds2civc2107ds3civc801dscivc802dscivc803dscivc902dscivc904dscivc904ds2civc904ds3civc905dscivc907dscivc908ds1civc908ds2civc914ds1civc914ds2civc917dscivivicjrbcladclamclapclarkclassclassicclassicsclassiestclaudeclawclayclaymorecleancleaningclear-lake-forgecleavercliffclintclioclipclip-udk-a17-6clip-udk-f-97clip-usclip-us-77closeclosedclosed6107wcloseoutcoastcoatedcoatingcobaltcobracocobococobolocodmcoffeycoffincoinscoldcolemancollectcollectablecollectiblecollectiblescollectioncollection1028collection3019collectiona9654collectiona9p93collectionakp90collectionakp9pcollectionap90collectorcollectorscolorcolorbonehornewoodcoloredcolorfulcolorscolourcombatcombocommemorativecommunitycompactcompanioncomparisoncompasscompellingcompletecompletioncomplexconditionconfiscatedcongressconspiracystuffcontouredconvictcooglercookcoolcoolhandcoopercoppercopperheadcopycoralcoralnebulacorbitcorecoredcorelesscoriancornercorradobillcorriecorsacorsicancortecostumecougarcouldcouldncourtyardcouteaucovercover-udk-a181-37cover-udk-usa-188cover-us-ch-126coverscoverus-ch-114cowhandcoyotecpm-154cpm-s30vcraftcraftedcraftscraftsmancraftsmashipcraigcranecrawfordcrazycreatingcrestcrimsoncrococrosscrowdercrushercsabacuibourtiacunashircurrycurvacustoimcustomcustom'90custom-madecustomedcustomizedcustomscustoncutlerycutwalacuzrcyberd-01d-06d-09d-vourdaggerdaggers-includingdailydakedaledalibordamadamacoredamasdamascsdamascusdamascus-mokume-ivory-ctdamascus-steel-bladedamascusbluedamascuscocobolodamascusdamascusdamascusengraveddamascusfeatherdamascusg10damascusm390damascusmammothdamascusmokumetimascusdamascusmopdamascussdamascuss35vndamascusskd-11damascusskd11damascusstagdamascustitaniumdamascustooldamascusvg-10damascuswooddamaskdamastdamasteeldamastmesserdamaststahldamscusdamwooddanieldarceydarkdarreldartmouthdavedaviddavidsondavisdaysdealdealerdealsdeathdebtdecepticon2decepticon2tacticaldecorateddecorativedeeddeejodeepdeerdefcondefectsdefenddefensedehongdelicadelightdeltadeluciadeluxedepotdescriptiondesertdesigndesigneddesignsdesktopdettdeviantdevildevindiamonddickdickweberknivesdiegodifferencedifferentdilluviodiluviodiplomatdippolddirkdisasterdiscontinueddisplaydisplayeddividenddixondkc-101dkc-105dkc-139dkc-169dkc-312dkc-38dkc-45dkc-46dkc-591dkc-592dkc-597dkc-613dkc-614dkc-617dkc-619dkc-62-bldkc-62-wdkc-621dkc-63dkc-66dkc-67dkc-70dkc-71dkc-72dkc-726dkc-76dkc-783dkc-96dkc45dm902dmascusdmfrel-damadmtwdoctordoctor'sdolphindomastdominatordonedorolitedoubledoucettedougdownsdozendozormedracodragondragonskindreamcatcherdreamsdressdresseddrifterdrillsdropdrop-pointds93xdualduaneduckdukedumchusduncandunkerleydupontdurabilitydurabledwainedwyerdyeddynastydz-5203-modz-5205-mweacheagleeasyeatonebayebonyedcknifeedgeedgeseditionedwardseggerlingeickhornel02delanelderelectrodeseleganceelegantelementselementumelephantelevatorelevenabelijahelishewitzeliteelmaxelvenemazingembretsenemissaryemotionemperorenchantressenduraendura4engineengravengraveengravedengraverengravingengreavedenlanentireentityepicericertilescapeeskinsespadasespecialyestateetchetchedetzlereurofighterevansevereveryeverydayexarchexcellentexclusiveexculisiveexecutiveexistsexoticexpensiveexperienceexplosionexpoexponentexporterexposedexpressexquisiteexskeliburextremaextremeeyesf-61f-63f-85f-supersonicf011fabricatedfabulousfactoryfadefadedfakefallingfallknivenfancyfangfastfatcarbonfatherfauxfavoritefeatherfecasfeelfeistyfellhoelterfenrirferrumfever'fiberfiberg10fiddlebackfieldfieldsfiggyfighterfightingfilefile-workfile-work-us-08file-work-us-75filedfileingfileworkfileworkedfilletfincafinchfindfinefinishfinishedfinnishfirefirestormfirstfishfishermanfishingfivefixedfl-002flagflakeflakesflameflamedflatflickflightflipflipperflitchflowflowerflowersflytaniumfm214fm215fn79fo-2007fo-2035fo-2081foilfoilcarbonfoldfoldefoldedfolded-forgingfolderfolderfoldingfoldersfoldingfoldingpocketfoltsfongfontenilleforceforestforgeforgedforgingforsetifossilfossilizedfossilsfoundfox-1fox521dbrfox521dlbfraleyframeframelockframesfrancefrankfranklinfredfreefreemanfrenchfreshfrictionfridayfriedlyfriezefrontfrontierfs13cbc-2fs13cbd-5fs296z-2fs298z-1fs301f-2fs307z-1fs318z-2fs321z-2fs324z-2fs478b-5fukutafullfulldressfullyfusionfvs011400fx-521dlbg-10g10cfg10roseg10titaniumgallaghergaloregaragegarnetgategb1039gb1099gb1129gb1160gb1161gb1162gb1164gb1167gb1179gb1180gb1241gb1244gb1245gb1250gb1268gb1396gb1581gb329gdt035gearbestgearheadgearldgedraitisgeminigemsgentgent'sgentacgentilegentlemangentleman'sgentlemensgenuinegeorgegermangermanygettinggeweihgiftgiftsgiganticgilbreathgillgillesgivegiveawaygl-10damgloryglovesglowgo17goatgodfathergoldgold-platedgoldengoldenrodgoldscrewgonegoodgorgeousgorskigottagottagegovernorgracegradegranatgrapesgrasshoppergravitygraygray-blackgray-bonegreatgreengreenblackgreggrenadillgreygrimsmogrindgrindhousegripgripsgrizzlygrizzlybladesgroomsmegroomsmengroovegroovedgroundgrovergryblkguardguardianguideguillocheguitargunshingunstockgvdvgysingeh300-dhackberryhacksawhaddockhadehadeshadlehadroshagenhallmarkedhalloweenhammerhammeredhanclehandhand-forgedhand-madehand-made-damascushand-pickedhandcrafthandcraftedhandehandedhandelhandforgedhandlhandlehandle-ch-37handle1074handledhandleshandletacticalhandmadhandmadehandmdehansharaharaldhardhardesthardnesshardwoodharkinsharleyharpiaharpoonharringtonharseyhartkopfhatthaweshawkhawkbillhawkinshayeshazakurahdc889heartstopperheatheavyheirloomheisthellionhelpheltonhematitehendrixhenryherbertzherehermanheronherringhfd-050hgdk007hh-10176hibbonshidehideyoshihidraulichigginshighhigh-endhighlyhigohigonokamihikarihikinghindererhippohirohistoricalhistoryhitchmoughhkbokerhogueholidayholsterhomemadehoneyhookshorizionhorizonhornhorn-udk-112hornbeamhornehornewoodhorsehostetlerhoundhourhowardhugehuge1850hummerhummingbirdhundredshuneerhunterhunter-factoryhuntershuntinghuntingcampinghuntingcampingfishinghuntingfishinghuntingfoldingbowietrackerkarambithuntinghandmadeleatherhuntinglothuntsmanhurryhursthuskyhydraulichydrus-02ieyasuiharaillegalillusionimbulaimpactimperiumimpiimpressionsimpressiveinchinchesincisorinciteinclincludeincredibleincrediblyindiaindianindustryinexpensiveinfernoinlaidinlayinlay'springinlaysinnerinsetinsiderintegraintegralinterestinginterframeinterlockinterruptinvestmentirbisironironwoodishamisonadeissardissueitalianitaliansitaloitalyitemivoryivsshj16cj1925t-dgcfjackjacksjacksonvillealjadejademanjagdmesserjaguarjamesjamiejangtanogjangtanonjangtanongjanuaryjapaesejapanjapanesejaroszjasonjaygerjazzjellyjensjeremyjerryjessejewelryjiggedjk-2djnr1035jo-034jodyjoeljohnjointjointsjokejudyjuliejulyjumbojunglejuniperjunkjunkerjunker2junkojuriyjustjutejw416k-22k0048k0049k0128chavesk1019d1k1024a4k1024a5k1027a4k1027a6k1027a7k1036b3k1039d1k1041a6k1046d1k1056a4k110damascusk2009a3k2009a4k201k2026bb1k2027d1k3044d2k380k385k3dpdcfk3tdcfk414k454k484k4blsdk4brsdk6428kabutkajikalangkalfayankamikanekomakanetsunekangkanseptkarambitkasatkakasperkasumikatakirakatanakatmandukatsukb-504kb508kdm0006ke-f55kebabkeelkeithkellykerinitekerinite-us-ch-49kershawkestrelkestrel'blaze'keychainkeyholekhalsaki3302b1kickstandkikyokilijkindkingking'skiouskiousjuliekirikirinitekirinite-udk-f-110kirinite-us-ch-06kiristyvkissingkitchenkizerkizlyarkknivesklappmesseklappmesserkm-102knfeknifknifeknife'chikiri'knife'doc'knife-dlcknife-edcknife-fatknife-giftknife-japaneseknife-linerknife-niwbknife-stunningknife-vintageknife12-pcsknife131eknife287knifeboneknifebrassknifecenterknifecopperknifedamascusknifedisassemblyknifedyedknifeeasyknifeedcknifeengraveknifehandmadefinishknifehornknifehuntingcampingknifeknivesknifelinerknifemadeknifemakerknifemakingknifepineconeknifepocketknifereadyknifereviewknifesknifesheathknifesteelknifestyleknifeworksknigeknightkniveknivesknives-set-03knives-set-08knives-set-14knives-set-17knives-set-20knives-set-29knives-set-31knives-set-33knives-set-37knives-set-40knives-set-41kniveslimitedkniveslockkniveslotknivespocketknockoutkojikolourkonrokukoreakoreankoslankoyamakrammeskratoskriegarkrisks1660damku055ekubeykubeybarracudakubeyknifekukrikuliskungfukusumikwaikenkyoceral-20l-28l-42l-43l01dl21-1056l31-1005l31-1410l31-1414labellaconicoladderladyladyalagenlagerlaguiolelaminatelancetlapislargelarimarlaserlastlatelaunchlavalayerlayeredlayerslazulilc10900lc11500lc22550le006le801z-2leaderleafleatheleatherleaveleavesleekleftlegacylegendarylegionaryleichtlemparkanlengthleninleo-damastleopardleopard-damastleroylesnichiylevelleverlevineleyasulibertylifelightlightfootlightninglightslightspeedlillelillielimitedlin-us-73lin-us-74linderlinearlinelocklinerliner-locklinerlocklinerslinklinnerlocklintaslionlionsteellittlelivelizardlk5015dlmc-1204dloadedlobolochsalocklock-117lock-backlock-ch-35lock-udk-105lock-udk-106lock-udk-111lock-us-102lock-us-104lock-us-255lock-us-41lockbacklockcs-137lockcs-149lockcs-151lockcs-160lockcs-181lockinglockudk-a227-19loganlombardlondonerlonelonglongshiplongworthlooklordlot020lotharlotslottlouislouisianaloveloydlozadalso1-dlst8800dmnlst8800dullt-01lubeluciferluminouslunaslutavoyluvthemknivesluxurylyhentm0078m0111m0151m0182m01mb739damm0216m0287m250m390m4890m4i6182m6182m7482m857vm9936m9966m9994macassarmacawmachetemachinemackrillmacustamaddmademagmamagnetsmagnummahoganymahogonymajesticmakemakermakersmakhamakingmamamammothmaniagomantismanualmanufakturmaplemarblemarbledmarblesmarcmarfionemarkmarkermarkusmarlinmarshmarshalmarshallmartinmarymassmassaromastadonmastedonmastermasterpiecemastodonmaterialmaterialsmatrixmattemaxwellmaxxmayomc-0010dmc-0012dmc-0013dmc-0014drmc-0019dmc-0022dmc-0023dmc-0031dmc-0036dmc-0052dmc-0073dmc-0074dmc-0076dmc-0092dmc-0111dmc-0112dmc-0114bdmc-0121dmc-0122drmc-0145rmc-0146mc-016mc-0161dmc-0164dmc-10dmc-111dmc-112dmc-113dmc-114dmc-121dmc-122drmc-123dmc-125dmc-126dmc-126gmc-13dmc-14dmc-15dmc-163dmc-164-dmc-164dmc-16dmc-17dmc-181dmc-182dmc-183dmc-184dmc-185dmc-18dmc-2mc-202mc-211dmc-212dmc-213dmc-22dmc-25dmc-26dmc-3mc-31dmc-32dmc-33dmc-34dmc-35dmc-36dmc-37cmc-37dmc-52dmc-53dmc-53drmc-54drmc-7mc-71drmc-72dmc-73dmc-74dmc-74dimc-74drmc-75dmc-76dmc-76dimc-76dpmc-77dmc-77dimc-77drmc-78dmc-79dmc-79dpmc-92dmc0041cmc0114bdmc0161dmc124dmc161dmc163dmccluremcconnellmchenrymckennamcu-mc31dmcu114dmcu121dmcu122drmcu123dmcu124dmcu12dmcu14dmcu15dmcu161dmcu162dmcu181dmcu183dmcu184dmcu23dmcu31dmcu33dmcu37cmcu41cmcu71dmcu73dmcu79dmcustameasuresmeatmeatcraftermechanicalmechanismsmedievalmediterraneanmediummegamelvinmen'smercatormercurymerlinmessermetalmeteoritemeteroritemexicanmexicomeyermicartamicarta-udk-223micartamothermicartatitaniummichaelmickmicromicrotechmidlandmikemike'whiskers'mikimikkelmikovmilanomilitarymillionmillitmindminimini-bmini-gmini-spathaminiatureminiblueminitrapperminoweminsmintmintnewmintyminutesmiragemirrormistakemixedmiyamotomkm-maniagomkmfl01-dmkmfl02-dmna-1022mnandimngp-8736mobilemochamodelmodeledmodelsmodernmoellermohibmokimoku-timokumemokumeblackmokutimolarmollettamonarchmoneymongoosemonkeymonthsmoonmoosemoremosaicmosiacmostmothermotorcyclemotosukemountainmoverms-167ms-2241ms-3737ms-4901ms-4915mt01dmuelamullermultimulti-functionalmusakamusashimushroommusickmuskratmustmustangmusuhmycartamysterymythmytonagaonailsnajanakewoodnakirinaminapanativenaturalnaturenauticalnavajanavajonavynbtcsdkrbgnealneatnebulanecknecklacenedfossnesstreetnetworknevernevlingnevling'snewbeautifulnewootznibsnicenichenicholsnicknickelnickleniconifenightnightforcedamascusnighthawknightmarenini'sninjanironishijinnishjinnitronkvdnoahnoblenobunaganorrisnorthnorthernnottnoutonovabladesnowlandnr02nr03nr04nr07nr08nr09nr18nr20nr24nr25nr31nr32nr35nr39nr41nr42nr43nr44nrw3nrw6nullnumbernumberednutsnwfcsdkrtgobsidianoccupiersoceanochsodinoodiumof40offeroistrichok4foliveolivewoodolsonone-handone-of-a-kindone-offonehandoniononlyopenopeningoperaopneroptionorangeorcaordinaryorianoriginalorleansornateorriellesorthodoxortisorvisosborneosograndeknivesospreyotter-messeroutdooroutdoorsoverallovereynderoverviewp01bo101damp01bo297damp01bo511damp01bo739dampacificpackpadaukpadoukpaintpaintedpakistanpakkapakkanenpakkawoodpalmpanesepanicpantherpaperpaperspaperworkparaparagonparangpardueparentsparkerparker-edwardsparrotpartpassionpataudpatenpatrioticpatternpatternedpattrenpattrencustompauapaulpayingpb-176pb-178pc38peachpeacockpeakpealpeanutpearpearlpeasepeelpelzerpenapengiunpenguinpeopleperalperfectperfectoperforatedperkinperridotpersianpersistencepersonalizedpeterpetitphilippinesphoenixphotospickpickspiecepiecespikattipikepilyavpimppinkpinkdamascuspinspintailpistolpitbosspivotpk01224pk01227pk01229pk01246pk01253pk01300pk01302pk01305pk01306pk01309pk01310pk01311pk01312pk02132pk02136pk05013pk05014pk05021pk05022pk05023pk05024pk05025pk08009plagueplainplainedgeplanetplatanplateplatedplatingplethirospmpspbkmdmpmpspgrmdmpocketpocketfolpocketfoldingpocketknifepockletclippodspohlpointpoketpolishpolishedpolkapolypolygonalpondponypoosiripopcornpoplarpopularpoputchikposisipostpouchpoundspowderpowerpraterprattpraxispre-benchmadepredatorpremiumpreparedprepperspresentpresentationpressprestigepretatoutpreviewpreypricedprimeprinceprintprintingpristinepro-techproblemprocessproductionproductsprojectsproponentprotechprotoprototypepullerpumapunisherpurchasepurduepurplepuukkopyritepythonqingqs131-aqs131-sqsp131-equalityquantumquartzquestquickquincequincewoodr1123-dr1173-dr1303-dr2065r2sg2radarraderaindopraindropraindrprainyraisonrajputknivesralphram'sramborampuriranchrancherrandallrandomrarerare-remingtonrare1235raskratchetratioravenrazorrc04rc05rc06rc12rc15rea010rea019rea09readreadyreak4sdrealreaterebarreceivedreciperecurveredwoodreedusreesereevereevesrehmanreifreleaseremarkableremerremingtonremontistarepeatedlyrepublicrescueresiresimenresinrestorationresultretailersreticulanretiredreturnedrevealedrevealsreviewreviewingreviewsrhinorickriderrietveldrifflerightrikerikyurisen-us-18risen-us-76riserriverrk-4061rk-4283rk-4284robertrobinsonrockrockeyerocksteadrogerrollroninroosterrootroserosethrosewoodrotoblockroughroxonroxstarrubbedrubbercopperrudolphruplerussellrussiarussianrusskiyrusslockrustedrusticrustyrwl34s-04s-06s-10s-11s-12s-14s-16s-166s-18s-19s-21s-22s-23s-30s-31s110s1661s30vs3140s35vns45vns90vsabersaddlehornsafetysajisakaisalesallysaloonsalvationsalvosambarsamiersamiorsamuraisan-misandsandalsandalwoodsandbarsanderssandlewoodsanmaesantasantokusantossapphiresapphiressatinsavagesavantsayasblshikarisc52scabbardscalescalesscallionscarabscaryschoemanschradeschwartzschwarzerscorpionscottscoutscrapsscreamshawscrewscrewsscrimscrimshawscrubberscullsculptedsculptureseahorsesealseashellseasonsebenzasecondssecretseedseensekiseki-japanselfsellsellersentinalseptemberserialseriesserratedset-11shabazzshadowshallotshamasshamwarishapesharshardbladesharksharpsharpedsharpensharpenersharpeningsharpestsharpnessshavingsshawsheashealthsheatsheathsheath037sheathboxsheathssheepsheepsfootsheetshellshellsshermanshiffershikarishinshinrashipshippingshipsshirasayashirogorovshoeshogunshokuninshootoutshopshortshortsshotshouldshowshredshreddedshunshurapsiberiansiccarisicilysicklesidesidekicksides-damascus-foldingsigilsignaturesignedsilversilverbonesilverdamascussimeonsimonssimplesinghsinglesisterssitiviensixleafsizeskeletonskinskinnerskinningskirmishskullskyfallskylinesl-04slabslashsleeperslimslimlineslipslip-jointslipjointsmallsmallestsmithsmkesmokysmoothsnakesnakeskinsnakewoodsnakewoodtitaniumsnipersnowsnubnosesolesolisolidsolingensolosomesongsonssouthsouthernsovietspacespainspaltedspanspanishspartanspearspearpointspecialspectrespeedsafespg2spiderspinespiritsportsspringspringssprintsprucespydercospyderospydiechef-titanium-lc200n-folding-pocket-knife-lsq6078841squiresr-1sr-2sr1drsr2dlsr2drsr2drgssctst223st401stabstabilizedstagstagantlerstagestainlessstaminastaminawoodstandstaplerstaplesstarstarozhilstarsstartstationerystauersteaksteamsteelsteelaluminumsteelblacksteelcoppersteelcraftsteelesteellotsteelpocketsteelssteeltitaniumsteiersteigerwaltsterilesterkhsterlingstevestevenstianlessstickstidhamstilettostilletostingstingraystockstockingstockmanstonestonesstonewashstoneworksstoneworks-mammothstormstraightstraightbackstrategicstrazh-2streamstrelitstretchstriderstrikestringsstripestripedstrizhstrongstrykerstubbystückstudstuffstuffersstunnerstunningsturgisstylestylessuchatsuchat-custom-folding-knife-damascus-steel-engraving-black-pearl-dragon-art-k02sullivansultansupersuperbsuperlocksurgicalsurprisesurprisessurvsurvivasurvivalsuttonsuwadasvarnswaggerswanswarowskyswayswedenswedishsweetswiftswirlswissswitchswitchbladeswordswordssynergysynergy3syntheticszilaskit-rext12-dpt1810gt2026bc1tacticaltacticsltactilitytaigatail-locktaiwanesetaketakeritakestakeshitakeshi'chikiri'talentedtalismantanbotangtanktantotapetarpontaschenmessertaylorsetotb52117tb62110tbfm214teachesteaktechtechniquetechrontecnocuttelltemperedtempesttentaratepeterrifyingterrysknifestoreterzuolatestteststexastexasamericantexturedtf4330thaithailandthanksthemetheorythickthiersthitathomasthompsonthorthornthoughtsthrasherthreethujathumbthumbscrewthunderbirdthuyati-cftiblacktiblackbluetibluetibrownticftidamascustiestigertiger-damasttigerbambootighetigoldtimascustimavotimbertimberwolftimetinkertinustiretirpitztirpitz-damascustishredtispintispinetitantitaniumtitaniumblueblacktitaniumcarbontitaniumcftitaniumcoraltitaniumdamascustitaniumg10titaniumtimascustitimascustitwilltobintoddtogattatogethertoimintastomahawktommytonytooltoolstoothtoothpicktopaztopotopstorrenttortoistortoisetotallytoucantourismtr-3trackertraditiontraditionaltrailtrailblazertrailingtransitiontransparenttrapertrappertrapperlocktraveltredbgytredfgytreetreebrandtrendytriggertrivisatrouttroutmantryingts1drts1dsbmts1dsgmtsubatsuchitu-untuliptunatungstenturdturenturkeyturkishturnturnbullturningturquoiseturtletusk-bothtuxedotwilighttwilltwisttwistedtwistfulltwosuntydeustypetyphoonu0026u0026w609u125du126du127dud-0031udaraudk-01udk-f-101uk-699uk-701uk-719ukrainaukrainianultemultraum-4851um-5049umboxingunboxingunfoldinguniqueunknownunleashedunusedunusualupdateupdatedurbanus-ch-115us-ch-119us-ch-136us-ch-95usa-greenusa-pb-266-busa-pb-267-busa-pb-270-busedussrutilityutopianva5840cbva5840fcva5944tiva5964tiblva5978fcvagabondvalachovicvaletvalleyvalvevanhoyvariantvaryag-2vegasvegasmanveinvelociraptorvelvet-linedvendettavernonversesveryvespertiliovg-10vg-10spydvg-10vg-2vg10vicarvictorianvictorinoxvideoviewviewsvikingvillersvilliersvintagevioletblueviperviragovisionvivantvk0022vk0067vk8136vlogvojkovoorhiesvorsmavoyagervp02vp03vp04vp06vp07vp08vp10vp100vp101vp102vp103vp11vp118vp14vp15vp16vp18vp19vp20vp21vp22vp24vp30vp31vp35vp36vp37vp38vp39vp41vp42vp43vp44vp45vp46vp47vp48vp49vp50vp51vp52vp55vp56vp61vp62vp63vp64vp65vp66vp67vp68vp69vp71vp72vp73vp74vp75vp78vp79vp81vp82vp84vp87vp90vp92vp93w1759wakizashiwalkwalkerwalnutwalruswalterwarenskiwarrenwarriorwashwasherswaterwaterfallwatsonwavewayneweaveweberwedgeweekweekenderweilandweinmuellerweirdestweldedwengewerewesternwesthuizenwharncliffwharncliffewheelerwherewhiplashwhiskerswhitakerwhitewhittakerwhittlerwholesalewidderwifewildwilliamwilliamswillumsenwilsonwiltonwinewinklerwinstonwinterwirewith-linerwith3with325with35with4withbackwithbluewithbonewithbrasswithbronzewithclip-withcustomwithdamascuswithengravedwithfilewithfinewithhwithkerinitewithleatherwithlinerwithlockwithmammothwithpocketwithquincewoodwithserialwithsheathwithsheathswithstagewithsteelwithtwithtiwithtrackwithtsheathwizardwolfwomenwoodwood-udk-f-87wood-udk-f-89wood-udk-f-90woodenwoodhornewoodswoollywoolywootzworkworkedworkmanshipworkshopworldwornwrongwsheathwu-shuwyvernx-seriesy-startyearyearsyellowyellowhorseyorkyoroiyoshiyoutubeshortsyukikazeyvc-10yvc-37z28-damastz5822vz5823vzadirazatorizdp-189zdp189zebrazelanciozermattzingzinkerzipperedzirczirconiumzomezorianzukuri

Categories

Flickr Photogallery

Subscribe Newsletter

subscribe with FeedBurner

Handmade Folding Knife. Ed Vanhoy. Damascus Blade. Unused. Excellent

  • October 5, 2019 at 7:09 am
Handmade-Folding-Knife-Ed-Vanhoy-Damascus-Blade-Unused-Excellent-01-rj
Handmade Folding Knife. Ed Vanhoy. Damascus Blade. Unused. Excellent
Handmade Folding Knife. Ed Vanhoy. Damascus Blade. Unused. Excellent
Handmade Folding Knife. Ed Vanhoy. Damascus Blade. Unused. Excellent
Handmade Folding Knife. Ed Vanhoy. Damascus Blade. Unused. Excellent
Handmade Folding Knife. Ed Vanhoy. Damascus Blade. Unused. Excellent
Handmade Folding Knife. Ed Vanhoy. Damascus Blade. Unused. Excellent
Handmade Folding Knife. Ed Vanhoy. Damascus Blade. Unused. Excellent
Handmade Folding Knife. Ed Vanhoy. Damascus Blade. Unused. Excellent
Handmade Folding Knife. Ed Vanhoy. Damascus Blade. Unused. Excellent
Handmade Folding Knife. Ed Vanhoy. Damascus Blade. Unused. Excellent
Handmade Folding Knife. Ed Vanhoy. Damascus Blade. Unused. Excellent

Handmade Folding Knife. Ed Vanhoy. Damascus Blade. Unused. Excellent
Handmade liner lock from Ed Vanhoy. Unused in excellent condition with one very light scratch on front bolster. Blade is stainless Damascus with integral guard. Blade is tight and centered with good opening snap. Bolsters and liners are 416 stainless steel with a satin finish. Scales are dark ironwood with no chips or cracks. Comes in a new zipper pouch. Streaks and smudges are fingerprints and polish residue. Shadows and bubbles are from the camera. Ships to 50 states only. The item “Handmade Folding Knife. Ed Vanhoy. Damascus Blade. Unused. Excellent” is in sale since Tuesday, October 1, 2019. This item is in the category “Collectibles\Knives, Swords & Blades\Collectible Folding Knives\Modern Folding Knives\Custom & Handmade”. The seller is “gargisse” and is located in Ione, California. This item can be shipped to United States, United Kingdom, Denmark, Romania, Slovakia, Bulgaria, Czech republic, Finland, Hungary, Latvia, Lithuania, Malta, Estonia, Australia, Greece, Portugal, Cyprus, Slovenia, Sweden, South Korea, Taiwan, South africa, Thailand, Belgium, France, Hong Kong, Ireland, Netherlands, Poland, Spain, Italy, Germany, Austria, Bahamas, Israel, Mexico, New Zealand, Singapore, Norway, Qatar, Kuwait, Bahrain, Croatia, Malaysia, Colombia, Costa rica, Dominican republic, Panama, Trinidad and tobago, Guatemala, Honduras, Brunei darussalam, Iceland, Cambodia, Sri lanka, Luxembourg, Martinique, Pakistan, Uruguay.
  • Modified Item: No
  • Country/Region of Manufacture: United States
  • Blade Material: Stainless Damascus
  • Lock Type: Liner
  • Blade Type: Drop Point
  • Blade Edge: Plain
  • Dexterity: Ambidextrous
  • Type: Pocketknife
  • Year: Current
  • Number of Blades: 1
  • Opening Mechanism: Manual
  • Handle Material: Ironwood
  • Brand: Ed Vanhoy
  • Authenticity: Original

Handmade Folding Knife. Ed Vanhoy. Damascus Blade. Unused. Excellent