Tags

-f-14-mintpre-owned-new-set-15-swordchef-udk-udk-04-udk-1-udk-110-udk-114-udk-20-udk-3-udk-4-udk-5-udk-7-udk-a187-13-udk-a44-07-udk-f-105-us-100-us-103-us-109-us-71-us-98-us-ch-155-us-ch-198-us-ch-200-us-ch-204-us-ch-224-us-f-2010042c0110ivssh01bo102dam01bo222dam01bo223dam01bo297dam01bo478dam01bo739dam01bo909dam01hk02dam01mb180dam01mb739dam01mb946dam0212d0450cfdams1-781-of-a-kind10-16110-pcs100-pcs1006c21006c31007e4100mm100pcs100th100x1015v11023d11024a101024a41047a21047a31047a41050ann1056a51058b51068a41069a11084a310cr15comov10ifg10pc10pcs10tipd10withcoa10zpgyd11''110084dam110129dam110144dam110150dam110190dam110237dam110239dam110617dam110618dam110715dam110db110dm110oz110th110v110x1990111101dam111103dam111104dam111621dam111d112021dam112022dam112032dam112116dam112123dam112545dam1132015dam1132018dam117477dam119-pcs11tipd12-pcs120-layer121d12damascus12th130mm131-a131-e131-q131-s131a135-085213sn140147dam14231d14c28n15-pcs15pc1600dambk1600damckt160th1620dambk1620damckt162d1660cfdam1660dam1660dambk1660damckt1660dnbb1670blkdam1670nbdam16oz17-pcs171d175damascus175mm1760dam1776grydam1802gd-bk1802gdbk1802gdgn1812grydam1815gd1815gdgy1817gsd-bk1821gdbk1821gsdbk1821gsdbu021821gsdgn1839g-dcf1839gdcf1839gsd-odg1840dam1840damckt1841g-tdb1841g-tdp1850inch1870oldam1889-198918th1900s19010cds219010cds31925ltdm1943-721990s19inch19th1damascus1db0071foh1million2-342-582-782-blade20-2020-pcs2003ds12020t12028dp2065a42065b520cm20cv20th2103ds321043ds121st22040f-ds1220mm23024ds1238damascus24-pcs241-dd-1241-dr-1kp2445dam24damascus25-pcs25in25pcs26damascus27-327damascus27th2blade2riz3-143-783-9163-inch30-titanium30blade30damascus30th312-dsd31blade32blade32damascus33-titanium33damascus34-titanium3488d234damascus34in34oz34titanium35''damascus35-titanium35blade35in35th35titanium361dsd36damascus36oz36titanium375''37in37titanium38damascus38in396-mck39damascus39titanium3damascus3inch3pcs3piece4-1840damascus40pc40th413''damascus440c45''45ozair46''463dcb470-131475'47ozair485-151485-1714blood4pcs50ozair50pc51405l52-pcs52100nickel525db52ozair535-3535bk-2535gry-1544d55-040758hrc5980fcm5custom5damascus5hgk5pcs6-pcs6002cfo6002cfo-11d6002cfo-14d604ds604dst60hrc60th6102-12d6102cfo-11d6102cfo-12d6125-16165dam61hrc6254d6265d62hrc63nf65''6516e67-layer670dm-5026ai4v6al4v710-144710ds72oz7500dam757-1517777dam7pcs7suchat7william8-pcs803ds3803k-18805z-8bc80mm814ds816e-28210dmn8210dst85-layer8800d8800d-ce8800d-mn8800d-mop8800dcb8800dmn8800dmop8800dul8amna8inches8pcs8pg2900p8903ds2903ds3904ds3908-161911ds929p95mma-work-of-arta03-pa0459a0459clonea2927a2936a2946a2968a2980a4716a4800a523a5964tiblabaloneabcaabgenutztenableaboinaabsolutelyaccipiteraccordingacidaconditionacrylicactuallyadmitsaf-3affordablyafricaafricanafsaagateahadaircraftairkataishatechajtraderak601al-adb164alabamaalanalaskaalbacetealbatrossalecallenalligatoralloyalmostaloxalumaluminiumaluminumaluminumwoodalvelyamaizingamazingamazonamberamboinaambooamboynaamericanamethystamiriteamnaanaxancientandersonandreandrewandroidandyangeloangledanimalankromanlterannivanniversaryannualanodisedanodizedanodizedoveanomalyanondizedanonimusansoantelopeanthroposantiantiqueantlerantlersantonantonioao3-papartappalachianappaloosaapparitionaprilarbolitoarchaeoarchitecharcitecharcticarcusargentariaarizonaarmorarmyarnoarrakisarrivedarrowart-arthurartisanartisancutleryartisonartistartsarvenisashleyasiaasm7323asmrassemblyassistassistedassistedplainassitedassortedasticusastronautat-1210at-1555atacatlanticats-34attemptingattentionatz-1802gd-glatz1802gdbkatz1815gdbkatz1815gdgyatz1815gsdbkaubeyaubracauthor'sauthorizedauthorshipautoautomaticavailableawesomeaxesaxisayckayothayaazraelaztecb-12b-udk-ck-36b-udk-ck-40b04-wmmcb05-mctb10darkbabababybackbacklockbacknobackpocketbaconbadlandsbailoutbakedbakerbaklashbakubalbachbalbachdamastbalibalisongballballsbambibamboobancheebandbanderasbankbanneretbanterbareknuckbareknucklebarkbarlowbaronbarracudabarrelbarrybarsbartrugbasicbasketbasketweavebassbassmanbastionbatmanbatterfliesbattlebb14bb15beadbeadblastbeadblastlightningstrikebearbearinbearingbearingsbeastbeatsbeautifulbeautifullbeautybeaverbeenbeetlebeggbeginnerbeginnersbegleiterbeingbelievebeltbenchbenchmadebergbergambernardbertiebespokebestbestechbestechmanbetterbewarebhaltairbidenbiggestbikebiker-1biker-2bikersbillbilletbillybiorkman'sbirchbirdsbirdseyebiriukovbirthbirthdaybl07abl07bbl07dblackblack-lipblackblueblackbronzeblackgrayblacklipblackorangeblackredblacksmithblacksmithingblackwashblackwhitebladbladeblade-foldingblade-kb503blade-kb504bladebolsterbladedbladegraybladehandlebladesbladeshowbladeshow2023bladesmithbladesmithingbladesmithsbladeworksblairblaneblastblastedblazerblondbloodbloodybluebluebeadblueblackbluedbluesatinbluewhiteblurbm15080-1bmk02lbnb3340dbnibbo01130bo02574bo03240bo03287bo110662dambo112116dambo84damboarboardbobbybocotebohlerbohrernbokerboldbolsterbolsteredbolstersbolsters-cd-142bolsters-udk-221bolsters-udk-f-76boltboltsbondbonebone-a05-05bone-f-23bone-us-ch-111bonebonebonehornebonehornewoodbonestagbonewoodbonewoodhornbonewoodhornebonusboomerangbootbosebossbottleboudiccaboughtbovibovinebowieboxpaperssheathboyfriendbr0242bradbradebrancobrandbrandantbrasbrassbravobrazenbreakbreakerbrendbrendwwbrettbrianbridgebriefingbrilliantbringbrittonbrokebronzebrownbrowningbrucebt1810gbt2008abt2102gbt2103gbt2103hbt2103ibt2301ebubbabuchnerbuckbuck110sbucknbearbucksbudgetbudk-a194-20buffalobugoutbuildbuildingbuiltbulkbullbulldogbulletbullmastiffbulltuskbumblebunchbunhichibunkabunnyburgundyburingburlburlapburlwoodburnleyburnsburntburrbuschbushbushcrafbushcraftbushibusinessbusterbutchbutcherbutterflybuttonbuyerbuyersbuyingbx-8bx-8abx-8dambyrnac-390c-tekc01cc10jbbpc10jbopc10tidc10tipdc10zpgydc113cfpdc11fpnbdc11jbbpc11jbopc11tidc11tipdc11zpgydc127gpivdc18026e-ds1c19010c-ds2c19010c-ds3c19010c-ds4c20011-ds1c20040d-ds1c20041b-ds1c2004ds-1c20063b-ds1c20075a-ds1c20075b-ds1c20075d-ds1c2015ds-1c2024ds-1c2102dsc2103ds-2c2103ds-3c2103ds3c211tipc22025b-ds1c22036c22036-ds1c22036-ds2c22036ds2c23017-ds1c23017ds1c23028-ds1c23040b-ds1c23060c23080-ds1c234-ac41cf40thc801dsc803ds-3c903dsc903ds2c904ds-3c907c-ds1c907dsc908ds-1c908ds-2c90gfblpdc914ds2ca74174cablecabochoncachetcactuscadmuscaffreycaimancalderoncaliforniacallcalligraphycalycamarocamelcamocampcampercampingcanarycanistercannoncanoecanvascanyoncapecarboncarbonfibercardboardcardsmancarltoncarriedcarrillocarrilloairkatcarrycarsoncartercartoncarvecarvedcarvingcasecase-damascuscassowarycasteelcastlegatecataclystcatalinacatchingcbit-13cbit-14cbit-15ccb1centauricentennialcentercentofanteceramiccerfcertificatecertificationcf-elitecftich-51ch-54ch-57ch-75ch115chachekachadchainchainschainsawchallengechamblinchannelchaptercharliecharltoncharredchaschb062cheapcheburkovcheckeredcheckingcheetahchefchefschenchesnutchesterchestnutchevalierchiefchimerachinachinesechinnockchipschiselchivechollachopperchoppingchrischristianitychristmaschronicchubbychuckchuncircacitrinecitycivc2002ds1civc2003ds1civc2010ds1civc2020ds1civc2024ds2civc2107ds3civc801dscivc802dscivc803dscivc902dscivc904dscivc904ds2civc904ds3civc905dscivc907dscivc908ds1civc908ds2civc914ds1civc914ds2civc917dscivivicjrbcladclamclapclarkclassclassicclassicsclassiestclaudeclawclayclaymorecleancleaningclear-lake-forgecleavercliffclintclioclipclip-udk-a17-6clip-udk-f-97clip-usclip-us-77clockcloseclosedclosed6107wcloseoutclubcoastcoatedcoatingcobaltcobracobrateccocobococobolocodmcoffeycoffincogentcoinscokecoldcoldsteelknivescoldsteelsilvereyecolemancollectcollectablecollectiblecollectiblescollectioncollection1028collection3019collectiona9654collectiona9p93collectionakp90collectionakp9pcollectionap90collectorcollectorscollisioncolorcolorbonehornewoodcoloredcolorfulcolorscolourcombatcombocommemorativecommunitycompactcompanioncomparisoncompasscompellingcompletecompletioncomplexcondconditionconfiscatedcongressconnoisseurconspiracystuffcontouredconvictcooglercookcoolcoolhandcoopercoppercopperheadcopycoralcoralnebulacorbitcorecoredcorelesscoriancorkscrewcornercorradobillcorriecorsacorsicancortecorvettecostumecottoncougarcouldcouldncourtyardcouteaucovercover-udk-a181-37cover-udk-usa-188cover-us-ch-126coverscovertcoverus-ch-114cowhandcoyotecpm-154cpm-s30vcraftcraftedcraftscraftsmancraftsmanshipcraftsmashipcraigcranecrawfordcrazycreatingcrestcrimsoncrktcrococrosscrossbarcrowdercrowncrushercsabacuibourtiaculexcunashircurlycurrycurvacustoimcustomcustom'90custom-madecustomedcustomizedcustomscustoncutlerycutwalacuzrcybercybind-01d-06d-09d-vourdaggerdaggers-includingdailydakedaledalibordam130damadamacoredamacusdamasdamascsdamascusdamascus-mokume-ivory-ctdamascus-steel-bladedamascusbladedamascusbluedamascusbronzedamascuscocobolodamascusdamascusdamascusengraveddamascusfeatherdamascusg10damascusgolddamascusm390damascusmammothdamascusmokumetimascusdamascusmopdamascussdamascuss35vndamascusskd-11damascusskd11damascusstagdamascusstonewasheddamascustitaniumdamascustooldamascusvg-10damascuswooddamaskdamastdamasteeldamastmesserdamaststahldamscusdamwooddanieldarceydarkdarkmatterdarreldartmouthdavedaviddavidsondavisdaysdealdealerdealsdeathdebtdecemberdecepticon2decepticon2tacticaldecorateddecorativedeeddeejodeepdeerdefcondefconjungleknifedefconknifedefectsdefenddefensedefinitelydehongdelicadelightdeltadeluciadeluxedemonstrationdepotdescriptiondesertdesigndesigneddesignsdesktopdetaileddettdeviantdevildevindiamicidiamonddickdickweberknivesdiegodifferencedifferentdilluviodiluviodiplomatdippolddirkdisasterdiscontinueddispatchdispatchknivesdisplaydisplayeddividenddixondkc-101dkc-105dkc-139dkc-169dkc-312dkc-38dkc-45dkc-46dkc-591dkc-592dkc-597dkc-613dkc-614dkc-617dkc-619dkc-62-bldkc-62-wdkc-621dkc-63dkc-66dkc-67dkc-70dkc-71dkc-72dkc-726dkc-76dkc-783dkc-96dkc45dm902dmascusdmfrel-damadmtwdoctordoctor'sdolabdolphindomastdominatordonedorolitedoubledoucettedougdownsdozendozormedps15dracodragondragonflydragonhidedragonskindreamcatcherdreamsdreamtechdressdresseddrifterdrillsdropdrop-pointds93xdskfsdualduaneduckdukedumchusduncandunkerleydupontdurabilitydurabledwainedwyerdyeddynastydz-5203-modz-5205-mweacheagleeasyeatonebayebonyedcknifeedgeedgeplayedgeseditionedwardseggerlingeickhornel02delanelderelectrodeseleganceelegantelementselementumelephantelevatorelevenabelijahelishewitzeliteelmaxelvenemazingembretsenemissaryemotionemperorenchantressendelaenduraendura4engineengravengraveengravedengraverengravingengreavedenlanentireentityepicepoxyericertilescapeeskinsespadasespecialyestateetchetchedetzlereurofighterevansevenevereveryeverydayeverydaycarryexarchexcellentexceptionalexclusiveexculisiveexecutiveexistsexoticexpeditionexpensiveexperienceexplorerexplosionexpoexponentexporterexposedexpressexquisiteexskeliburextremaextremeeyesf-61f-63f-85f-supersonicf011f286fabricatedfabulousfactorfactoryfadefadedfakefalconfallingfallknivenfancyfangfastfatcarbonfatherfauxfavoritefeatherfeaturingfecasfeelfeistyfellhoelterfenrirfermiferrumfever'fiahfiberfiberdamascusfiberg10fiddlebackfieldfieldsfiggyfighterfightingfilefile-workfile-work-us-08file-work-us-75filedfileingfileworkfileworkedfilletfincafinchfindfinefingersfinishfinishedfinnishfirefirestormfirstfishfishermanfishingfivefixedfl-002flagflakeflakesflameflamedflatflickflightflipflipperflitchflowflowerflowersflytaniumfm214fm215fn79fo-2007fo-2035fo-2081foilfoilcarbonfoldfoldableknifefoldefoldedfolded-forgingfolderfolder-onefolderfoldingfoldersfoldingfoldingknifefoldingpocketfoltsfongfontenillefoosaforceforestforgeforgedforgingforsetiforyoufossilfossilizedfossilsfoundfox-1fox521dbrfox521dlbfragfraleyframeframelockframesfrancefrancescatofrankfranklinfredfreefreemanfreezefrenchfreshfrictionfridayfriedlyfriezefrontfrontierfs13cbc-2fs13cbd-5fs296z-2fs298z-1fs301f-2fs307z-1fs318z-2fs321z-2fs324z-2fs478b-5fukutafullfulldressfullyfusionfuturefvs011400fx-521dlbg-10g10carbong10cfg10roseg10tig10titaniumgabongallaghergaloregaragegarnetgategb1039gb1099gb1129gb1160gb1161gb1162gb1164gb1167gb1179gb1180gb1241gb1244gb1245gb1250gb1268gb1396gb1581gb329gdt035gearbestgearheadgearldgedraitisgeminigemsgentgent'sgentacgentilegentlemangentleman'sgentlemensgenuinegeorgegeorgiagermangermanygettinggeweihghostgiftgift10giftsgiganticgilbreathgillgillesgivegiveawaygl-10damglorygloverglovesglowgo17goatgodfathergodsgoldgold-platedgoldclassgoldengoldenrodgoldscrewgonegoodgorgeousgorskigottagottagegovernorgrabgracegradegranatgrapesgrasshoppergravitygraygray-blackgray-bonegreatgreengreenblackgreggrenadillgreygrimsmogrindgrindergrindhousegripgripsgrizzlygrizzlybladesgroomsmegroomsmengroovegroovedgroundgrovergryblkguardguardianguibouritaguideguillesguillocheguitargunshingunstockguthookgvdvgysingeh300-dhackberryhacksawhaddockhadehadeshadlehadroshagenhallmarkedhalloweenhammerhammeredhanclehandhand-forgedhand-madehand-made-damascushand-pickedhandcrafthandcraftedhandehandedhandelhandforgedhandlhandlehandle-ch-37handle1074handledhandleshandletacticalhandmadhandmadehandmdehansharaharaldhardhardesthardnesshardwoodharkinsharleyharpiaharpoonharringtonharseyhartkopfhatthavornhaweshawkhawkbillhawkinshayeshazakurahdc889heartstopperheatheavyheirloomheisthellionhelpheltonhematitehendrixhenryherbertzherehermanheronherringhfd-050hgdk007hh-10176hibbonshidehideyoshihidraulichigginshighhigh-endhigh-finhighlyhightronhigohigonokamihikarihikinghindererhippohirahirohistoricalhistoryhitchmoughhkbokerhoefthogueholeholesholidayholmholsterhomemadehoneyhookshorizionhorizonhornhorn-udk-112hornbeamhornehornethornewoodhorsehostetlerhoundhourhowardhr412mopdmht01purhuaaohugehuge1850hughhummerhummingbirdhundredshuneerhunterhunter-factoryhuntershuntinghuntingcampinghuntingcampingfishinghuntingfishinghuntingfoldingbowietrackerkarambithuntinghandmadeleatherhuntinglothuntsmanhurryhursthuskyhydraulichydrus-02icarusideasieyasuiharaillegalillusionimbulaimpactimperiumimpiimpossibleimpressionsimpressiveinchinchesincisorinciteinclincludeincludedincredibleincrediblyindiaindianindustryinexpensiveinfernoinitialinlaidinlayinlay'springinlaysinnerinoxinsetinsiderintegraintegralinterestinginterframeinterlockinterruptinvestmentirbisironironwoodishamisonadeissardissueitalianitaliansitaloitalyitemivoryivsshj-capej16cj1925at3-bwdj1925at3-wdj1925l-tdmj1925t-dgcfjackjacksjacksonvillealjadejademanjagdmesserjaguarjamesjamiejangtanogjangtanonjangtanongjanuaryjapaesejapanjapanesejaroszjasonjasperjaygerjazzjeffjefferyjellyjensjeremyjerryjessejewelryjiggedjk-2djnr1035jo-034jodyjoeljohnjointjointsjokejs02-gb-dpjudyjuliejulyjumbojunglejuniperjunkjunkerjunker2junkojuriyjustjutejw416k-22k0048k0049k0128chavesk1001a6k1019d1k1023b4k1024a4k1024a5k1027a4k1027a6k1027a7k1032d1k1034a2k1034b1k1034z2k1036b3k1039d1k1041a6k1046d1k1046d2k1052a5k1052a7k1056a4k1068a5k1069a1k1069a3k1074c2k1075t5k1077a5k1078a3k1078a5k1079a3k1079a4k1080a2k1084b3k1089b2k1090a5k1094v2k1094v5k1099v3k110damascusk1122a2k2009a3k2009a4k201k2020t2k2025a8k2026bb1k2027d1k2030c2uk2037a2k2038a5k2038a6k2065a3k2087a2k3030d1k3044d2k380k385k3dpdcfk3tdcfk414k454k484k4blsdk4brsdk610tcdk6428kabutkajikalangkalfayankamikanekanekomakanetsunekangkanseptkanspetkarambitkasatkakasperkasumikatakirakatanakatlakatmandukatsukb-504kb258dkb508kdm0006ke-f55kebabkeelkeenkeepingkeithkelginkellykenshinkerinitekerinite-us-ch-49kershawkestrelkestrel'blaze'keychainkeyholekeytailkg174khalsaki3302b1kickstandkikyokilijkindkingking'skinzuakiouskiousjuliekirikirinitekirinite-udk-f-110kirinite-us-ch-06kiristyvkissingkitchenkizerkizercutlerykizerkanekizerkniveskizlyarkk006bkknivesklappmesseklappmesserkm-102knfeknifknifeknife'chikiri'knife'doc'knife-dlcknife-edcknife-fatknife-giftknife-japaneseknife-linerknife-niwbknife-stunningknife-vintageknife12-pcsknife131eknife287knifeboneknifebrassknifecenterknifecopperknifedamascusknifedisassemblyknifedyedknifeeasyknifeedcknifeengraveknifehandmadefinishknifehornknifehuntingcampingknifejoyknifeknivesknifelinerknifemadeknifemakerknifemakingknifepineconeknifepocketknifereadyknifereviewknifesknifesheathknifesteelknifestyleknifeworksknigeknightkniveknivesknives-damascusknives-premiumknives-set-03knives-set-08knives-set-14knives-set-17knives-set-20knives-set-29knives-set-31knives-set-33knives-set-37knives-set-40knives-set-41kniveslimitedkniveslockkniveslotknivespocketknockoutkoftgarikojikoleksiyonkolourkonrokukoreakoreankorvidkoslankoyamakrammeskratoskriegarkriskrudokryoks1660damku055ekubeykubeybarracudakubeyknifekudukukrikuliskungfukusumikwaikenkyoceral-01l-03l-20l-28l-39l-42l-43l01dl21-1056l31-1005l31-1410l31-1414labellaconicoladderladyladyalagenlagerlaguiolelaminatelancetlapislargelarginlarimarlaserlastlatelaunchlautielavalayerlayeredlayerslazulilc10900lc11500lc22550le006le801z-2leaderleadvilleleafleatheleatherleaveleavesleekleftlegacylegallegendarylegionaryleichtlemparkanlengthleninleo-damastleopardleopard-damastleroylesnichiyletterlevelleverlevineleyasulibertylifelightlightfootlightninglightslightspeedlightweightlillelillielimitedlin-us-73lin-us-74linderlinelinearlinelocklinerliner-locklinerlocklinerslinklinnerlocklintaslionlionsteellittlelivelizardlk5015dlmc-1204dloadedlobolochsalocklock-117lock-backlock-ch-35lock-udk-105lock-udk-106lock-udk-111lock-us-102lock-us-104lock-us-255lock-us-41lockbacklockcs-137lockcs-149lockcs-151lockcs-160lockcs-181lockinglockudk-a227-19loganlokilombardlondonerlonelonglongshiplongworthlooklookedlordlot020lotharlotslottlouislouisianaloveloydlozadalso1-dlst8800dmnlst8800dullt-01lubeluciferluminouslunaslutavoyluvthemknivesluxurylyhentm0078m0111m0151m0182m01mb739damm0216m0287m250m390m4890m4i6182m6182m7482m857vm9936m9966m9994macassarmacawmachetemachinemackrillmacustamaddmademagmamagnetsmagnummahoganymahogonymainmajesticmakemakermakersmakesmakhamakingmamamammothmandumanfredmaniagomantismanualmanufakturmaplemarblemarbledmarblesmarcmarfionemarkmarkermarkusmarlinmarshmarshalmarshallmartinmarvelousmarymasamunemaserinmassmassaromastadonmastedonmastermasterpiecemastodonmaterialmaterialsmatrixmattemaxacemaxwellmaxxmayomc-0010dmc-0012dmc-0013dmc-0014drmc-0019dmc-0022dmc-0023dmc-0031dmc-0036dmc-0052dmc-0073dmc-0074dmc-0075dmc-0076dmc-0078dmc-0092dmc-0111dmc-0112dmc-0114bdmc-0121dmc-0122drmc-0145rmc-0146mc-0146gmc-016mc-0161dmc-0164dmc-10dmc-111dmc-112dmc-113dmc-114dmc-121dmc-122dmc-122drmc-123dmc-125dmc-126dmc-126gmc-13dmc-14dmc-15dmc-163dmc-164-dmc-164dmc-16dmc-17dmc-181dmc-182dmc-183dmc-184dmc-185dmc-186dmc-18dmc-2mc-202mc-211dmc-212dmc-213dmc-223dmc-22dmc-23dmc-25dmc-26dmc-3mc-31dmc-32dmc-33dmc-34dmc-35dmc-36dmc-37cmc-37dmc-52dmc-53dmc-53drmc-54drmc-7mc-71drmc-72dmc-73dmc-74dmc-74dimc-74drmc-75dmc-76dmc-76dimc-76dpmc-77dmc-77dimc-77drmc-78dmc-79dmc-79dpmc-91dmc-92dmc0041cmc0114bdmc0161dmc124dmc161dmc163dmccluremcconnellmchenrymckennamcu-mc31dmcu114dmcu121dmcu122drmcu123dmcu124dmcu12dmcu14dmcu15dmcu161dmcu162dmcu181dmcu183dmcu184dmcu23dmcu31dmcu33dmcu37cmcu41cmcu71dmcu73dmcu79dmcustameasuresmeatmeatcraftermechanicalmechanismsmedievalmediterraneanmediummeetsmegamelvinmen'smercatormercurymerlinmeshmessermetalmeteoritemeteroritemexicanmexicomeyermicartamicarta-udk-223micartamothermicartatitaniummichaelmickmicromicrotechmicrotechknivesmidlandmikemike'whiskers'mikimikkelmikovmilanomilitarymillingmillionmillitmindminimini-bmini-gmini-spathaminiatureminiblueminitrapperminoweminsmintmintnewmintyminutesmiragemirrormistakemitchellmixedmiyamotomkm-maniagomkmfl01-dmkmfl02-dmm361cmna-1022mnandimngp-8736mobilemochamodelmodeledmodelsmodernmoellermohibmokimoku-timokumemokumeblackmokutimolarmollettamonarchmoneymongoosemonkeymonthsmoonmooremoosemoremortalmosaicmosiacmostmothermotorcyclemotosukemountainmoverms-167ms-2241ms-3737ms-4901ms-4915mt01dmuelamullermultimulti-functionalmultideploymusakamusashimushroommusickmuskmuskratmustmustangmusuhmycartamysterymythmytonagaonailsnajanakewoodnakirinaminapanativenaturalnaturenaturelnauticalnavajanavajonavynbtcsdkrbgnealneatnebulanecknecklacenedfossneedlenefarisnegativenesstreetnetworkneurohapticnevernevlingnevling'snewbeautifulnewlawmannewootznibsnicenichenicholesnicholsnicknickelnickleniconifenightnightforcedamascusnighthawknightmarenini'sninjanironishijinnishjinnitronkvdnoahnoblenobunaganorrisnorthnorthernnottnoutonovabladesnowlandnr02nr03nr04nr07nr08nr09nr18nr20nr24nr25nr31nr32nr35nr39nr41nr42nr43nr44nrw3nrw6nugznullnumbernumberednutsnwfcsdkrtgo'connelloberobsceneobsidianocasooccupiersoceanochsodinoodiumof40offeroistrichok4foknifeoliveolivewoodolsonone-handone-of-a-kindone-offonehandoniononlyopenopeneropeningoperaoperationopneroptimaoptionorangeorcaordinaryorianoriginalorionorleansornateorriellesorthodoxortisorvisosborneosbourneosograndeknivesospreyotherotter-messeroutdooutdooroutdoorsoutrideroverallovereynderoverviewownedoxenmarketozarkp01bo101damp01bo297damp01bo511damp01bo739dampacificpackpadaukpadoukpaintpaintedpairpakistanpakkapakkanenpakkawoodpalmpampaspanesepanicpantherpaperpaperspaperworkparaparagonparamilitaryparangpardueparentsparkerparker-edwardsparrotpartpassionpataudpatenpatrickpatrikpatrioticpatternpatternedpattrenpattrencustompauapaulpayingpb-176pb-178pc38peachpeacockpeakpealpeanutpearpearlpeasantpeasepeelpelzerpenapengiunpenguinpeopleperalperfectperfectoperforatedperidotperkinperridotpersianpersistencepersonalpersonalizedpeterpetitpetoskyphilippinesphoenixphotospickpickspiecepiecespikattipikepilyavpimppinkpinkdamascuspinspintailpioneerpistolpitbosspivotpk01224pk01227pk01229pk01246pk01253pk01300pk01302pk01305pk01306pk01309pk01310pk01311pk01312pk02132pk02136pk05013pk05014pk05021pk05022pk05023pk05024pk05025pk08009pkdamaxplagueplainplainedgeplanetplasterboardplatanplateplatedplatingplaypleaseplethirospmpspbkmdmpmpspgrmdmpockpocketpocket-knifepocketedcpocketfolpocketfoldingpocketknifepocketknifespocketspockletclippodspohlpointpoketpolishpolishedpolkapolypolygonalpondponypoosiripopcornpoplarpopularpoputchikportableposisipositivepostpouchpoundspowderpowerpraterprattpraxispre-benchmadepredatorpremiumpreparedprepperspresentpresentationpressprestigepretatoutpreviewpreypricedpridgenprimeprinceprinslooprintprintingpristinepro-techproblemprocessproductionproductsprofessionalprojectsproponentprotechprotoprototypepullerpumapunisherpuppis-02gpurchasepurduepurplepuukkopyritepythonqilinqingqs131-aqs131-sqsp131-eqspknifequalityquantumquartzquasarquestquickquillonquincequincewoodquixoticr1123-dr1173-dr1303-dr2065r2sg2radarraderaindopraindropraindrprainyraisonrajputknivesralphram'sramborampuriranchrancherrandallrandomrapierraptorrarerare-1rare-remingtonrare1235raskraspratchetratiorattlesnakeravenrazorrc04rc05rc06rc12rc15rea010rea019rea09readreadyreak4sdrealrearreaterebarreceivedreciperecurveredorangeredwoodreedusreesereevereevesrehmanreifreleaserelicremarkableremerremingtonremontistarepeatedlyrepublicrescueresiresimenresinrestorationrestoredresultretailersreticulanretiredreturnedrevealedrevealsreveriereviewreviewingreviewsrex121rhinorickriderridgerietveldrifflerightrikerikyurisen-us-18risen-us-76riserritualriverrk-4061rk-4283rk-4284robertrobinsonrockrockeyerocksteadrogerrogersrollronanroninroosterrootroserosethrosewoorosewoodrotoblockroughroxonroxstarrs7901dbrubbedrubbercopperrudolphruplerussellrussiarussianrusskiyrusslockrustedrusticrustyrwl34rwl34pmc27s-04s-06s-10s-11s-12s-14s-16s-166s-18s-19s-21s-22s-23s-30s-31s-32s110s1661s30vs3140s35vns45vns90vsabersaboteursachsesaddlehornsafetysajisakaisakurasalesallysaloonsalvationsalvosambarsamiersamiorsamusamuraisan-misandsandalsandalwoodsandbarsanderssandlewoodsandstormsanmaesantasantokusantossapphiresapphiressatinsavagesavantsawcutsayasblshikarisc52scabbardscalescalesscallionscarabscaryschoemanschradeschwartzschwarzerscorpionscottscoutscrapsscreamshawscrewscrewsscrimscrimshawscrubberscullsculptedsculptureseahorsesealsealedseanseashellseasonsebenzasecondssecretseedseensekiseki-japanselectselfsellsellersengokusentinalsentinelseptemberserialseriesserratedset-11sf10dmblsf10dmbzshabazzshadowshallotshamasshamwarishapesharshardshardbladesharksharpsharpedsharpensharpenersharpeningsharpestsharpnessshavingsshawsheashealthsheatsheathsheath037sheathbkcsheathboxsheathssheepsheepsfootsheetshellshellsshermanshieldshiffershikarishinshinrashipshippingshipsshirasayashirogorovshockedshoeshogunshokuninshootoutshopshortshortsshotshouldshowshredshreddedshunshurapsiberiansiccarisicilysicklesidesidekicksides-damascus-foldingsigilsignaturesignedsilversilverbonesilverdamascussimeonsimonssimplesimplyorn8singhsinglesinkevichsisterssitiviensixleafsizeskeletonskikariskinskinnerskinningskirmishskullskyfallskylinesl-04slabslashsleeperslimslimlineslipslip-jointslipitslipjointsmallsmallestsmithsmkesmokysmoothsnakesnakeskinsnakewoodsnakewoodtitaniumsnipersnowsnubnosesodbustersolesolisolidsolingensolosolsticesomesomethingsongsonssoundsouthsouthernsovietspacespainspaltedspanspanishspartanspearspearpointspecialspeciallyspectacularspectrespeedsafespg2spiderspinespiritsportsspringspringssprintsprucespydercospyderospydiechef-titanium-lc200n-folding-pocket-knife-lsq6078841squeegeesquiresr-1sr-2sr1drsr2dlsr2drsr2drgssctst223st252st401stabstabilizedstablestagstagantlerstagestainedstainlessstainlessg10staminastaminawoodstandstaplerstaplesstarstarozhilstarsstartstationerystauersteaksteamsteelsteelaluminumsteelblacksteelbrasssteelcoppersteelcraftsteelesteelessteelgreensteellotsteelpocketsteelssteeltitaniumsteiersteigerwaltsterilesterkhsterlingstevestevenstianlessstickstidhamstienenstilettostilletostingstingraystitchstockstockingstockmanstonestonesstonewashstonewashedstoneworksstoneworks-mammothstoneworksdamascusstormstormhowlstrastraightstraightbackstrategicstrazh-2streamstreetstrelitstretchstriderstrikestringsstripestripedstrizhstrongstrongerstrykerstubbystückstudstuffstuffersstunnerstunningsturgisstylestylesstylishsuchatsuchat-custom-folding-knife-damascus-steel-engraving-black-pearl-dragon-art-k02sullivansultansunlongknivessupersuperbsuperhawksuperlocksupportsurgicalsurprisesurprisessurvsurvivasurvivalsurvivalgearsuttonsuwadasvarnsvordswaggerswanswarowskyswayswedenswedishsweetswellswiftswirlswissswitchswitchbladeswordswordssynergysynergy3syntheticszilaskit-10t-rext12-dpt1810gt1810ht1810it1810jt2026bc1tacticaltacticalgeartacticalgearztacticorixtacticsltactilitytaigatail-locktaiwanesetaketakeritakestakeshitakeshi'chikiri'talentedtalismantalktambolitanbotandytangtanktantotapetarkintarpontaschenmessertaylorsetotb52117tb61546damtb62110tbfm214teachesteaktechtechniquetechrontecnocuttelltemperedtempesttenabletenderfoottentaratepeterrifyingterrysknifestoreterzuolatesttestingteststexastexasamericantexturedtf4330tf4392-2tf4406thaithailandthanksthemetheorytheretheunsthickthiersthitathomasthompsonthorthornthoththoughtsthrasherthreethrillthujathumbthumbscrewthunderbirdthuyati-cftiblacktiblackbluetibluetibronzetibrownticfticoppertidamascustiestigertiger-damasttigerbambootighetigoldtigreentimascustimascusblacktimavotimbertimberwolftimetinkertinustinytippertipurpletiretirpitztirpitz-damascustishredtishreddedtispintispinetitantitaniumtitaniumblueblacktitaniumcarbontitaniumcftitaniumcoraltitaniumdamascustitaniumg10titaniummicartatitaniumtimascustitimascustitusvilletitwilltiwoodtobintoddtogattatogethertoimintastolerancetomahawktommytonytooltooletoolstoothtoothpicktopaztopotopstorrenttortoistortoisetotallytoucantourismtr-3trackertraditiontraditionaltrailtrailblazertrailingtranquiltransitiontransparenttrapertrappertrapperlocktraveltredbgytredfgytreetreebrandtrendytributetriggertriotrivisatrollskytrouttroutmantryingts1drts1dsbmts1dsgmtsubatsuchitu-untuckamoretuliptunatungstenturdturenturenzturkeyturkishturnturnbullturningturquoiseturtletusk-bothtuxedotwilighttwilltwisttwistedtwistfulltworowstworowsoftwosunstwosuntwosunknivestwosunstydeustypetyphoonu0026u0026w609u125du126du127dud-0031udaraudk-01udk-f-101uk-699uk-701uk-719ukrainaukraineukrainianultemultimateultraum-4851um-5022um-5049umboxingunboxingunconventionalunfoldunfoldinguniqueunknownunleashedunmatchedunusedunusualunveilingupcloseupdateupdatedurbanus-ch-115us-ch-119us-ch-136us-ch-95usa-greenusa-pb-266-busa-pb-267-busa-pb-270-busedussrutilityutopianv6355whva5840cbva5840fcva5944tiva5964tiblva5978fcva5980fcmvagabondvalachovicvalentinevaletvalleyvalvevanhoyvariantvaryag-2vegasvegasmanveinvelociraptorvelvet-linedvendettavernonversesversionvertigoveryvespertiliovg-10vg-10spydvg-10vg-2vg10vg10-c243fpnbdvg10damascusvicarvictorianvictorinoxvideoviewviewsvikingvillersvilliersvintagevioletblueviperviragovisionvivantvividvk0022vk0067vk8136vlogvojkovoorhiesvorsmavoyagervp02vp03vp04vp06vp07vp08vp10vp100vp101vp102vp103vp11vp118vp14vp15vp16vp18vp19vp20vp21vp22vp24vp30vp31vp35vp36vp37vp38vp39vp41vp42vp43vp44vp45vp46vp47vp48vp49vp50vp51vp52vp55vp56vp61vp62vp63vp64vp65vp66vp67vp68vp69vp71vp72vp73vp74vp75vp78vp79vp81vp82vp84vp87vp90vp92vp93vulpisw1759waitwakizashiwaldenwalkwalkerwalletwalmartwalnutwalruswalterwarenskiwarrenwarriorwashwasherswaterwaterfallwatsonwavewaveswaynewe21016-ds1we21026b-ds1weaponsweaveweberwedgeweekweekenderweidmannsheilweilandweinmuellerweirdestweldedwengewerewesternwesthuizenwestlindwharnciffewharncliffwharncliffewheelerwherewhiplashwhiskerswhitakerwhitewhittakerwhittlerwholesalewickedwidderwifewildwildernesswilliamwilliamswillumsenwilsonwiltonwinewinklerwinstonwinterwinterbladewirewith-linerwith3with325with35with4withbackwithbluewithbonewithbrasswithbronzewithclip-withcustomwithdamascuswithengravedwithfilewithfinewithhwithkerinitewithleatherwithlinerwithlockwithmammothwithnicholswithpocketwithquincewoodwithswithserialwithsheathwithsheathswithstagwithstagewithsteelwithtwithtiwithtrackwithtsheathwizardwolfwomenwoodwood-udk-f-87wood-udk-f-89wood-udk-f-90woodenwoodhornewoodswoollywoolywootzworkworkedworkmanshipworksworkshopworldwormwornwrongwsheathwu-shuwyvernx-seriesxituoxmasxziley-startyagayearyearsyellowyellowhorseyorkyoroiyoshiyoutubeyoutubeshortsyukikazeyvc-10yvc-37z28-damastz5822vz5823vzadirazatorizdp-189zdp189zebrazelanciozermattzerozingzinkerzipperedzirczirconiumzomezorianzt0450cfdamszukuri

Categories

Flickr Photogallery

Subscribe Newsletter

subscribe with FeedBurner

Boker Tree Brand Damascus Bog Oak Handle Folding Knife With Wood Case

  • October 15, 2017 at 3:32 pm
Boker Tree Brand Damascus Bog Oak Handle Folding Knife With Wood Case
Boker Tree Brand Damascus Bog Oak Handle Folding Knife With Wood Case
Boker Tree Brand Damascus Bog Oak Handle Folding Knife With Wood Case
Boker Tree Brand Damascus Bog Oak Handle Folding Knife With Wood Case
Boker Tree Brand Damascus Bog Oak Handle Folding Knife With Wood Case
Boker Tree Brand Damascus Bog Oak Handle Folding Knife With Wood Case
Boker Tree Brand Damascus Bog Oak Handle Folding Knife With Wood Case
Boker Tree Brand Damascus Bog Oak Handle Folding Knife With Wood Case
Boker Tree Brand Damascus Bog Oak Handle Folding Knife With Wood Case
Boker Tree Brand Damascus Bog Oak Handle Folding Knife With Wood Case
Boker Tree Brand Damascus Bog Oak Handle Folding Knife With Wood Case
Boker Tree Brand Damascus Bog Oak Handle Folding Knife With Wood Case

Boker Tree Brand Damascus Bog Oak Handle Folding Knife With Wood Case
Boker Tree Brand Damascus Lockback Folder in Wood Display Case. 1000 Year Old Bog Oak Handles Excellent Condition. Offered here is a Boker Tree Brand Damascus folding knife in wood display case. The blade is beautiful 300 layer Soligen Damascus Steel. The handles are ancient bog oak that is stated to be about 1000 years old. I believe this knife was a Limited Edition issued in the late 1990’s but it does not have a serial number on the knife or the paperwork so I cannot be certain. It measures about 4-1/4″ closed and 7-1/2″ open. Comes with wood display case and paperwork. The top of the display case has a few scratches and something that looks like glue residue along part of the top edge. This knife is from an estate sale; see my other auctions for more knives from this collection by a longtime knife collector. From a smoke-free and pet-free home. The item “BOKER TREE BRAND DAMASCUS BOG OAK HANDLE FOLDING KNIFE WITH WOOD CASE” is in sale since Saturday, October 14, 2017. This item is in the category “Collectibles\Knives, Swords & Blades\Collectible Folding Knives\Modern Folding Knives\Factory Manufactured”. The seller is “big*bob” and is located in Fullerton, California. This item can be shipped to United States.
  • Brand: Boker Tree Brand
  • Handle Material: Bog Oak
  • Blade Edge: Plain
  • Number of Blades: 1
  • Lock Type: Lockback
  • Opening Mechanism: Manual
  • Country/Region of Manufacture: Germany
  • Blade Range: 2.76 – 4in.
  • Blade Material: Damascus Steel

Boker Tree Brand Damascus Bog Oak Handle Folding Knife With Wood Case