Tags

-f-14-mintpre-owned-new-set-15-swordchef-udk-udk-04-udk-1-udk-110-udk-114-udk-20-udk-3-udk-4-udk-5-udk-7-udk-a187-13-udk-a44-07-udk-f-105-us-100-us-103-us-109-us-71-us-98-us-ch-155-us-ch-198-us-ch-200-us-ch-204-us-ch-224-us-f-2010042c0110ivssh01bo102dam01bo222dam01bo223dam01bo297dam01bo478dam01bo739dam01bo909dam01hk02dam01mb180dam01mb739dam01mb946dam0212d0450cfdams1-781-of-a-kind10-16110-pcs100-pcs1006c21006c31007e4100mm100pcs100th100x1015v11023d11024a101024a41047a21047a31050ann1056a51058b51068a41069a11084a310cr15comov10ifg10pcs10tipd10withcoa10zpgyd11''110084dam110129dam110144dam110150dam110190dam110237dam110239dam110617dam110618dam110715dam110db110dm110oz110th110v110x1990111101dam111103dam111104dam111621dam111d112021dam112022dam112032dam112116dam112123dam112545dam1132015dam1132018dam117477dam119-pcs11tipd12-pcs120-layer121d12damascus12th130mm131-a131-e131-q131-s131a135-085213sn140147dam14231d15-pcs15pc1600dambk1600damckt1620damckt162d1660cfdam1660dam1660dambk1660damckt1660dnbb1670blkdam1670nbdam16oz17-pcs171d175damascus175mm1760dam1776grydam1802gd-bk1802gdbk1802gdgn1812grydam1815gd1815gdgy1817gsd-bk1821gdbk1821gsdbk1821gsdbu021821gsdgn1839g-dcf1839gdcf1839gsd-odg1840dam1840damckt1841g-tdb1841g-tdp1850inch1870oldam1889-198918th1900s19010cds219010cds31925ltdm1943-721990s19inch19th1damascus1db0071foh1million2-342-582-782-blade20-2020-pcs2003ds12020t12028dp2065a42065b520cm20cv20th2103ds321043ds121st22040f-ds1220mm23024ds1238damascus24-pcs241-dd-1241-dr-1kp2445dam24damascus25-pcs25in25pcs26damascus27-327damascus27th2blade2riz3-143-783-9163-inch30-titanium30blade30damascus30th312-dsd31blade32blade32damascus33-titanium33damascus34-titanium3488d234damascus34in34oz34titanium35''damascus35-titanium35blade35in35th35titanium361dsd36damascus36oz36titanium375''37in37titanium38damascus38in396-mck39damascus39titanium3damascus3inch3pcs3piece4-1840damascus40pc40th413''damascus440c45''45ozair46''463dcb470-131475'47ozair485-151485-1714blood4pcs50ozair50pc51405l52-pcs52100nickel525db52ozair535-3535bk-2535gry-1544d55-040758hrc5980fcm5custom5damascus5hgk5pcs6-pcs6002cfo6002cfo-11d6002cfo-14d604ds604dst60hrc60th6102-12d6102cfo-11d6102cfo-12d6125-16165dam61hrc6265d62hrc63nf65''6516e67-layer670dm-5026ai4v6al4v710-144710ds72oz7500dam757-1517777dam7pcs7suchat7william8-pcs803ds3803k-18805z-8bc80mm814ds816e-28210dmn8210dst85-layer8800d8800d-ce8800d-mn8800d-mop8800dcb8800dmn8800dmop8800dul8amna8inches8pcs8pg2900p8903ds2903ds3904ds3908-161911ds929p95mma-work-of-arta03-pa0459a0459clonea2927a2936a2946a2968a2980a4716a4800a523a5964tiblabaloneabcaabgenutztenableaboinaabsolutelyaccipiteraccordingacidaconditionacrylicactuallyadmitsaf-3affordablyafricaafricanafsaagateahadaircraftairkataishatechajtraderak601al-adb164alabamaalanalaskaalbacetealbatrossalecallenalligatoralloyalmostaloxalumaluminiumaluminumaluminumwoodalvelyamaizingamazingamazonamberamboinaambooamboynaamericanamethystamiriteamnaanaxancientandersonandreandrewandroidandyangeloangledanimalankromanlterannivanniversaryannualanodisedanodizedanodizedoveanomalyanondizedanonimusansoantelopeanthroposantiantiqueantlerantlersantonantonioao3-papartappalachianappaloosaapparitionaprilarbolitoarchaeoarchitecharcitecharcticarcusargentariaarizonaarmorarmyarnoarrakisarrivedarrowart-arthurartisanartisancutleryartisonartistartsarvenisashleyasiaasm7323asmrassemblyassistassistedassistedplainassitedassortedasticusastronautat-1210at-1555atacatlanticats-34attemptingattentionatz-1802gd-glatz1802gdbkatz1815gdbkatz1815gdgyatz1815gsdbkaubeyaubracauthor'sauthorizedauthorshipautoautomaticavailableawesomeaxesaxisayckayothayaazraelaztecb-12b-udk-ck-36b-udk-ck-40b04-wmmcb05-mctb10darkbabababybackbacklockbacknobackpocketbaconbadlandsbailoutbakedbakerbaklashbakubalbachbalbachdamastbalibalisongballballsbambibamboobancheebandbanderasbankbanneretbanterbareknuckbareknucklebarkbarlowbaronbarracudabarrelbarrybarsbartrugbasicbasketbasketweavebassbassmanbastionbatmanbatterfliesbattlebb14bb15beadbeadblastbeadblastlightningstrikebearbearinbearingbearingsbeastbeatsbeautifulbeautifullbeautybeaverbeggbeginnerbeginnersbegleiterbeingbelievebeltbenchbenchmadebergbergambernardbertiebespokebestbestechbestechmanbetterbewarebhaltairbidenbiggestbikebiker-1biker-2bikersbillbilletbillybiorkman'sbirchbirdsbirdseyebiriukovbirthdaybl07abl07dblackblack-lipblackblueblackbronzeblackgrayblacklipblackorangeblacksmithblacksmithingblackwashblackwhitebladbladeblade-foldingblade-kb503blade-kb504bladebolsterbladedbladegraybladehandlebladesbladeshowbladeshow2023bladesmithbladesmithingbladesmithsbladeworksblairblaneblastblastedblazerblondbloodbloodyblueblueblackbluedbluesatinbluewhiteblurbmk02lbnb3340dbnibbo01130bo02574bo03240bo03287bo110662dambo112116dambo84damboarboardbobbybocotebohlerbohrernbokerboldbolsterbolsteredbolstersbolsters-cd-142bolsters-udk-221bolsters-udk-f-76boltboltsbondbonebone-a05-05bone-f-23bone-us-ch-111bonebonebonehornebonehornewoodbonestagbonewoodbonewoodhornbonewoodhorneboomerangbootbosebossbottleboudiccaboughtbovibovinebowieboxpaperssheathboyfriendbr0242bradbradebrancobrandbrandantbrasbrassbravobrazenbreakbreakerbrendbrendwwbrettbrianbridgebriefingbrilliantbringbrittonbrokebronzebrownbrowningbrucebt1810gbt2008abt2102gbt2103gbt2103hbt2103ibt2301ebuchnerbuckbuck110sbucknbearbucksbudgetbudk-a194-20buffalobugoutbuildbuildingbuiltbulkbullbulldogbulletbullmastiffbulltuskbumblebunchbunhichibunkabunnyburgundyburingburlburlapburlwoodburnleyburnsburntburrbuschbushbushcrafbushcraftbushibusinessbusterbutchbutcherbutterflybuttonbuyerbuyersbuyingbx-8bx-8abx-8dambyrnac-390c-tekc01cc10jbbpc10jbopc10tidc10tipdc10zpgydc113cfpdc11fpnbdc11jbbpc11jbopc11tidc11tipdc11zpgydc127gpivdc18026e-ds1c19010c-ds2c19010c-ds3c19010c-ds4c20011-ds1c20040d-ds1c20041b-ds1c2004ds-1c20063b-ds1c20075a-ds1c20075b-ds1c20075d-ds1c2015ds-1c2024ds-1c2102dsc2103ds-2c2103ds-3c2103ds3c211tipc22025b-ds1c22036c22036-ds1c22036-ds2c22036ds2c23017-ds1c23017ds1c23028-ds1c23080-ds1c234-ac41cf40thc801dsc803ds-3c903dsc903ds2c904ds-3c907dsc908ds-1c908ds-2c90gfblpdc914ds2ca74174cablecabochoncachetcactuscadmuscaffreycaimancalderoncaliforniacallcalligraphycalycamarocamelcamocampcampercampingcanarycanistercannoncanoecanvascanyoncapecarboncarbonfibercardboardcardsmancarltoncarriedcarrillocarrilloairkatcarrycarsoncartercartoncarvecarvedcarvingcasecase-damascuscassowarycasteelcastlegatecataclystcatalinacatchingccb1centauricentennialcentercentofanteceramiccerfcertificatecertificationcf-elitecftich-51ch-54ch-57ch-75ch115chachekachadchainchainschainsawchallengechamblinchannelchaptercharliecharltoncharredchaschb062cheapcheburkovcheckeredcheckingcheetahchefchefschenchesnutchesterchestnutchevalierchiefchimerachinachinesechinnockchipschiselchivechollachopperchoppingchrischristianitychristmaschronicchubbychuckchuncircacitrinecitycivc2002ds1civc2003ds1civc2010ds1civc2020ds1civc2024ds2civc2107ds3civc801dscivc802dscivc803dscivc902dscivc904dscivc904ds2civc904ds3civc905dscivc907dscivc908ds1civc908ds2civc914ds1civc914ds2civc917dscivivicjrbcladclamclapclarkclassclassicclassicsclassiestclaudeclawclayclaymorecleancleaningclear-lake-forgecleavercliffclintclioclipclip-udk-a17-6clip-udk-f-97clip-usclip-us-77clockcloseclosedclosed6107wcloseoutclubcoastcoatedcoatingcobaltcobracobrateccocobococobolocodmcoffeycoffincogentcoinscokecoldcoldsteelknivescoldsteelsilvereyecolemancollectcollectablecollectiblecollectiblescollectioncollection1028collection3019collectiona9654collectiona9p93collectionakp90collectionakp9pcollectionap90collectorcollectorscollisioncolorcolorbonehornewoodcoloredcolorfulcolorscolourcombatcombocommemorativecommunitycompactcompanioncomparisoncompasscompellingcompletecompletioncomplexcondconditionconfiscatedcongressconnoisseurconspiracystuffcontouredconvictcooglercookcoolcoolhandcoopercoppercopperheadcopycoralcoralnebulacorbitcorecoredcorelesscoriancorkscrewcornercorradobillcorriecorsacorsicancortecostumecottoncougarcouldcouldncourtyardcouteaucovercover-udk-a181-37cover-udk-usa-188cover-us-ch-126coverscovertcoverus-ch-114cowhandcoyotecpm-154cpm-s30vcraftcraftedcraftscraftsmancraftsmanshipcraftsmashipcraigcranecrawfordcrazycreatingcrestcrimsoncrktcrococrosscrossbarcrowdercrowncrushercsabacuibourtiaculexcunashircurlycurrycurvacustoimcustomcustom'90custom-madecustomedcustomizedcustomscustoncutlerycutwalacuzrcybercybind-01d-06d-09d-vourdaggerdaggers-includingdailydakedaledalibordam130damadamacoredamacusdamasdamascsdamascusdamascus-mokume-ivory-ctdamascus-steel-bladedamascusbladedamascusbluedamascusbronzedamascuscocobolodamascusdamascusdamascusengraveddamascusfeatherdamascusg10damascusgolddamascusm390damascusmammothdamascusmokumetimascusdamascusmopdamascussdamascuss35vndamascusskd-11damascusskd11damascusstagdamascusstonewasheddamascustitaniumdamascustooldamascusvg-10damascuswooddamaskdamastdamasteeldamastmesserdamaststahldamscusdamwooddanieldarceydarkdarkmatterdarreldartmouthdavedaviddavidsondavisdaysdealdealerdealsdeathdebtdecemberdecepticon2decepticon2tacticaldecorateddecorativedeeddeejodeepdeerdefcondefconjungleknifedefconknifedefectsdefenddefensedefinitelydehongdelicadelightdeltadeluciadeluxedemonstrationdepotdescriptiondesertdesigndesigneddesignsdesktopdetaileddettdeviantdevildevindiamicidiamonddickdickweberknivesdiegodifferencedifferentdilluviodiluviodiplomatdippolddirkdisasterdiscontinueddispatchdispatchknivesdisplaydisplayeddividenddixondkc-101dkc-105dkc-139dkc-169dkc-312dkc-38dkc-45dkc-46dkc-591dkc-592dkc-597dkc-613dkc-614dkc-617dkc-619dkc-62-bldkc-62-wdkc-621dkc-63dkc-66dkc-67dkc-70dkc-71dkc-72dkc-726dkc-76dkc-783dkc-96dkc45dm902dmascusdmfrel-damadmtwdoctordoctor'sdolabdolphindomastdominatordonedorolitedoubledoucettedougdownsdozendozormedps15dracodragondragonflydragonhidedragonskindreamcatcherdreamsdreamtechdressdresseddrifterdrillsdropdrop-pointds93xdskfsdualduaneduckdukedumchusduncandunkerleydupontdurabilitydurabledwainedwyerdyeddynastydz-5203-modz-5205-mweacheagleeasyeatonebayebonyedcknifeedgeedgeplayedgeseditionedwardseggerlingeickhornel02delanelderelectrodeseleganceelegantelementselementumelephantelevatorelevenabelijahelishewitzeliteelmaxelvenemazingembretsenemissaryemotionemperorenchantressendelaenduraendura4engineengravengraveengravedengraverengravingengreavedenlanentireentityepicepoxyericertilescapeeskinsespadasespecialyestateetchetchedetzlereurofighterevansevenevereveryeverydayeverydaycarryexarchexcellentexceptionalexclusiveexculisiveexecutiveexistsexoticexpeditionexpensiveexperienceexplorerexplosionexpoexponentexporterexposedexpressexquisiteexskeliburextremaextremeeyesf-61f-63f-85f-supersonicf011f286fabricatedfabulousfactorfactoryfadefadedfakefallingfallknivenfancyfangfastfatcarbonfatherfauxfavoritefeatherfeaturingfecasfeelfeistyfellhoelterfenrirfermiferrumfever'fiberfiberg10fiddlebackfieldfieldsfiggyfighterfightingfilefile-workfile-work-us-08file-work-us-75filedfileingfileworkfileworkedfilletfincafinchfindfinefinishfinishedfinnishfirefirestormfirstfishfishermanfishingfivefixedfl-002flagflakeflakesflameflamedflatflickflightflipflipperflitchflowflowerflowersflytaniumfm214fm215fn79fo-2007fo-2035fo-2081foilfoilcarbonfoldfoldableknifefoldefoldedfolded-forgingfolderfolderfoldingfoldersfoldingfoldingknifefoldingpocketfoltsfongfontenillefoosaforceforestforgeforgedforgingforsetiforyoufossilfossilizedfossilsfoundfox-1fox521dbrfox521dlbfragfraleyframeframelockframesfrancefrankfranklinfredfreefreemanfreezefrenchfreshfrictionfridayfriedlyfriezefrontfrontierfs13cbc-2fs13cbd-5fs296z-2fs298z-1fs301f-2fs307z-1fs318z-2fs321z-2fs324z-2fs478b-5fukutafullfulldressfullyfusionfuturefvs011400fx-521dlbg-10g10carbong10cfg10roseg10titaniumgabongallaghergaloregaragegarnetgategb1039gb1099gb1129gb1160gb1161gb1162gb1164gb1167gb1179gb1180gb1241gb1244gb1245gb1250gb1268gb1396gb1581gb329gdt035gearbestgearheadgearldgedraitisgeminigemsgentgent'sgentacgentilegentlemangentleman'sgentlemensgenuinegeorgegeorgiagermangermanygettinggeweihghostgiftgift10giftsgiganticgilbreathgillgillesgivegiveawaygl-10damgloryglovesglowgo17goatgodfathergodsgoldgold-platedgoldengoldenrodgoldscrewgonegoodgorgeousgorskigottagottagegovernorgrabgracegradegranatgrapesgrasshoppergravitygraygray-blackgray-bonegreatgreengreenblackgreggrenadillgreygrimsmogrindgrindergrindhousegripgripsgrizzlygrizzlybladesgroomsmegroomsmengroovegroovedgroundgrovergryblkguardguardianguibouritaguideguillesguillocheguitargunshingunstockguthookgvdvgysingeh300-dhackberryhacksawhaddockhadehadeshadlehadroshagenhallmarkedhalloweenhammerhammeredhanclehandhand-forgedhand-madehand-made-damascushand-pickedhandcrafthandcraftedhandehandedhandelhandforgedhandlhandlehandle-ch-37handle1074handledhandleshandletacticalhandmadhandmadehandmdehansharaharaldhardhardesthardnesshardwoodharkinsharleyharpiaharpoonharringtonharseyhartkopfhatthavornhaweshawkhawkbillhawkinshayeshazakurahdc889heartstopperheatheavyheirloomheisthellionhelpheltonhematitehendrixhenryherbertzherehermanheronherringhfd-050hgdk007hh-10176hibbonshidehideyoshihidraulichigginshighhigh-endhigh-finhighlyhightronhigohigonokamihikarihikinghindererhippohirohistoricalhistoryhitchmoughhkbokerhogueholesholidayholmholsterhomemadehoneyhookshorizionhorizonhornhorn-udk-112hornbeamhornehornethornewoodhorsehostetlerhoundhourhowardhr412mopdmhuaaohugehuge1850hughhummerhummingbirdhundredshuneerhunterhunter-factoryhuntershuntinghuntingcampinghuntingcampingfishinghuntingfishinghuntingfoldingbowietrackerkarambithuntinghandmadeleatherhuntinglothuntsmanhurryhursthuskyhydraulichydrus-02icarusideasieyasuiharaillegalillusionimbulaimpactimperiumimpiimpossibleimpressionsimpressiveinchinchesincisorinciteinclincludeincredibleincrediblyindiaindianindustryinexpensiveinfernoinitialinlaidinlayinlay'springinlaysinnerinoxinsetinsiderintegraintegralinterestinginterframeinterlockinterruptinvestmentirbisironironwoodishamisonadeissardissueitalianitaliansitaloitalyitemivoryivsshj-capej16cj1925at3-bwdj1925at3-wdj1925l-tdmj1925t-dgcfjackjacksjacksonvillealjadejademanjagdmesserjaguarjamesjamiejangtanogjangtanonjangtanongjanuaryjapaesejapanjapanesejaroszjasonjasperjaygerjazzjeffjefferyjellyjensjeremyjerryjessejewelryjiggedjk-2djnr1035jo-034jodyjoeljohnjointjointsjokejs02-gb-dpjudyjuliejulyjumbojunglejuniperjunkjunkerjunker2junkojuriyjustjutejw416k-22k0048k0049k0128chavesk1001a6k1019d1k1023b4k1024a4k1024a5k1027a4k1027a6k1027a7k1032d1k1034b1k1034z2k1036b3k1039d1k1041a6k1046d1k1046d2k1052a5k1056a4k1068a5k1069a1k1069a3k1074c2k1075t5k1077a5k1078a5k1080a2k1089b2k1094v2k1094v5k110damascusk1122a2k2009a3k2009a4k201k2020t2k2025a8k2026bb1k2027d1k2030c2uk2037a2k2038a5k2038a6k2065a3k2087a2k3044d2k380k385k3dpdcfk3tdcfk414k454k484k4blsdk4brsdk610tcdk6428kabutkajikalangkalfayankamikanekanekomakanetsunekangkanseptkarambitkasatkakasperkasumikatakirakatanakatlakatmandukatsukb-504kb258dkb508kdm0006ke-f55kebabkeelkeenkeithkellykenshinkerinitekerinite-us-ch-49kershawkestrelkestrel'blaze'keychainkeyholekeytailkg174khalsaki3302b1kickstandkikyokilijkindkingking'skinzuakiouskiousjuliekirikirinitekirinite-udk-f-110kirinite-us-ch-06kiristyvkissingkitchenkizerkizercutlerykizerkanekizerkniveskizlyarkk006bkknivesklappmesseklappmesserkm-102knfeknifknifeknife'chikiri'knife'doc'knife-dlcknife-edcknife-fatknife-giftknife-japaneseknife-linerknife-niwbknife-stunningknife-vintageknife12-pcsknife131eknife287knifeboneknifebrassknifecenterknifecopperknifedamascusknifedisassemblyknifedyedknifeeasyknifeedcknifeengraveknifehandmadefinishknifehornknifehuntingcampingknifejoyknifeknivesknifelinerknifemadeknifemakerknifemakingknifepineconeknifepocketknifereadyknifereviewknifesknifesheathknifesteelknifestyleknifeworksknigeknightkniveknivesknives-set-03knives-set-08knives-set-14knives-set-17knives-set-20knives-set-29knives-set-31knives-set-33knives-set-37knives-set-40knives-set-41kniveslimitedkniveslockkniveslotknivespocketknockoutkoftgarikojikoleksiyonkolourkonrokukoreakoreankorvidkoslankoyamakrammeskratoskriegarkriskrudokryoks1660damku055ekubeykubeybarracudakubeyknifekudukukrikuliskungfukusumikwaikenkyoceral-01l-03l-20l-28l-39l-42l-43l01dl21-1056l31-1005l31-1410l31-1414labellaconicoladderladyladyalagenlagerlaguiolelaminatelancetlapislargelarimarlaserlastlatelaunchlautielavalayerlayeredlayerslazulilc10900lc11500lc22550le006le801z-2leaderleafleatheleatherleaveleavesleekleftlegacylegallegendarylegionaryleichtlemparkanlengthleninleo-damastleopardleopard-damastleroylesnichiyletterlevelleverlevineleyasulibertylifelightlightfootlightninglightslightspeedlightweightlillelillielimitedlin-us-73lin-us-74linderlinelinearlinelocklinerliner-locklinerlocklinerslinklinnerlocklintaslionlionsteellittlelivelizardlk5015dlmc-1204dloadedlobolochsalocklock-117lock-backlock-ch-35lock-udk-105lock-udk-106lock-udk-111lock-us-102lock-us-104lock-us-255lock-us-41lockbacklockcs-137lockcs-149lockcs-151lockcs-160lockcs-181lockinglockudk-a227-19loganlokilombardlondonerlonelonglongshiplongworthlooklookedlordlot020lotharlotslottlouislouisianaloveloydlozadalso1-dlst8800dmnlst8800dullt-01lubeluciferluminouslunaslutavoyluvthemknivesluxurylyhentm0078m0111m0151m0182m01mb739damm0216m0287m250m390m4890m4i6182m6182m7482m857vm9936m9966m9994macassarmacawmachetemachinemackrillmacustamaddmademagmamagnetsmagnummahoganymahogonymainmajesticmakemakermakersmakesmakhamakingmamamammothmandumanfredmaniagomantismanualmanufakturmaplemarblemarbledmarblesmarcmarfionemarkmarkermarkusmarlinmarshmarshalmarshallmartinmarvelousmarymasamunemaserinmassmassaromastadonmastedonmastermasterpiecemastodonmaterialmaterialsmatrixmattemaxacemaxwellmaxxmayomc-0010dmc-0012dmc-0013dmc-0014drmc-0019dmc-0022dmc-0023dmc-0031dmc-0036dmc-0052dmc-0073dmc-0074dmc-0075dmc-0076dmc-0078dmc-0092dmc-0111dmc-0112dmc-0114bdmc-0121dmc-0122drmc-0145rmc-0146mc-0146gmc-016mc-0161dmc-0164dmc-10dmc-111dmc-112dmc-113dmc-114dmc-121dmc-122dmc-122drmc-123dmc-125dmc-126dmc-126gmc-13dmc-14dmc-15dmc-163dmc-164-dmc-164dmc-16dmc-17dmc-181dmc-182dmc-183dmc-184dmc-185dmc-186dmc-18dmc-2mc-202mc-211dmc-212dmc-213dmc-223dmc-22dmc-23dmc-25dmc-26dmc-3mc-31dmc-32dmc-33dmc-34dmc-35dmc-36dmc-37cmc-37dmc-52dmc-53dmc-53drmc-54drmc-7mc-71drmc-72dmc-73dmc-74dmc-74dimc-74drmc-75dmc-76dmc-76dimc-76dpmc-77dmc-77dimc-77drmc-78dmc-79dmc-79dpmc-92dmc0041cmc0114bdmc0161dmc124dmc161dmc163dmccluremcconnellmchenrymckennamcu-mc31dmcu114dmcu121dmcu122drmcu123dmcu124dmcu12dmcu14dmcu15dmcu161dmcu162dmcu181dmcu183dmcu184dmcu23dmcu31dmcu33dmcu37cmcu41cmcu71dmcu73dmcu79dmcustameasuresmeatmeatcraftermechanicalmechanismsmedievalmediterraneanmediummeetsmegamelvinmen'smercatormercurymerlinmeshmessermetalmeteoritemeteroritemexicanmexicomeyermicartamicarta-udk-223micartamothermicartatitaniummichaelmickmicromicrotechmidlandmikemike'whiskers'mikimikkelmikovmilanomilitarymillingmillionmillitmindminimini-bmini-gmini-spathaminiatureminiblueminitrapperminoweminsmintmintnewmintyminutesmiragemirrormistakemitchellmixedmiyamotomkm-maniagomkmfl01-dmkmfl02-dmna-1022mnandimngp-8736mobilemochamodelmodeledmodelsmodernmoellermohibmokimoku-timokumemokumeblackmokutimolarmollettamonarchmoneymongoosemonkeymonthsmoonmooremoosemoremortalmosaicmosiacmostmothermotorcyclemotosukemountainmoverms-167ms-2241ms-3737ms-4901ms-4915mt01dmuelamullermultimulti-functionalmusakamusashimushroommusickmuskratmustmustangmusuhmycartamysterymythmytonagaonailsnajanakewoodnakirinaminapanativenaturalnaturenauticalnavajanavajonavynbtcsdkrbgnealneatnebulanecknecklacenedfossnefarisnegativenesstreetnetworkneurohapticnevernevlingnevling'snewbeautifulnewootznibsnicenichenicholesnicholsnicknickelnickleniconifenightnightforcedamascusnighthawknightmarenini'sninjanironishijinnishjinnitronkvdnoahnoblenobunaganorrisnorthnorthernnottnoutonovabladesnowlandnr02nr03nr04nr07nr08nr09nr18nr20nr24nr25nr31nr32nr35nr39nr41nr42nr43nr44nrw3nrw6nullnumbernumberednutsnwfcsdkrtgo'connelloberobsceneobsidianocasooccupiersoceanochsodinoodiumof40offeroistrichok4foknifeoliveolivewoodolsonone-handone-of-a-kindone-offonehandoniononlyopenopeneropeningoperaoperationopneroptimaoptionorangeorcaordinaryorianoriginalorionorleansornateorriellesorthodoxortisorvisosborneosbourneosograndeknivesospreyotherotter-messeroutdooutdooroutdoorsoutrideroverallovereynderoverviewownedoxenmarketozarkp01bo101damp01bo297damp01bo511damp01bo739dampacificpackpadaukpadoukpaintpaintedpairpakistanpakkapakkanenpakkawoodpalmpampaspanesepanicpantherpaperpaperspaperworkparaparagonparamilitaryparangpardueparentsparkerparker-edwardsparrotpartpassionpataudpatenpatrickpatrioticpatternpatternedpattrenpattrencustompauapaulpayingpb-176pb-178pc38peachpeacockpeakpealpeanutpearpearlpeasantpeasepeelpelzerpenapengiunpenguinpeopleperalperfectperfectoperforatedperidotperkinperridotpersianpersistencepersonalpersonalizedpeterpetitpetoskyphilippinesphoenixphotospickpickspiecepiecespikattipikepilyavpimppinkpinkdamascuspinspintailpioneerpistolpitbosspivotpk01224pk01227pk01229pk01246pk01253pk01300pk01302pk01305pk01306pk01309pk01310pk01311pk01312pk02132pk02136pk05013pk05014pk05021pk05022pk05023pk05024pk05025pk08009pkdamaxplagueplainplainedgeplanetplasterboardplatanplateplatedplatingplaypleaseplethirospmpspbkmdmpmpspgrmdmpockpocketpocket-knifepocketfolpocketfoldingpocketknifepocketknifespockletclippodspohlpointpoketpolishpolishedpolkapolypolygonalpondponypoosiripopcornpoplarpopularpoputchikposisipositivepostpouchpoundspowderpowerpraterprattpraxispre-benchmadepredatorpremiumpreparedprepperspresentpresentationpressprestigepretatoutpreviewpreypricedpridgenprimeprinceprinslooprintprintingpristinepro-techproblemprocessproductionproductsprofessionalprojectsproponentprotechprotoprototypepullerpumapunisherpuppis-02gpurchasepurduepurplepuukkopyritepythonqilinqingqs131-aqs131-sqsp131-eqspknifequalityquantumquartzquestquickquillonquincequincewoodquixoticr1123-dr1173-dr1303-dr2065r2sg2radarraderaindopraindropraindrprainyraisonrajputknivesralphram'sramborampuriranchrancherrandallrandomrapierraptorrarerare-1rare-remingtonrare1235raskraspratchetratioravenrazorrc04rc05rc06rc12rc15rea010rea019rea09readreadyreak4sdrealrearreaterebarreceivedreciperecurveredorangeredwoodreedusreesereevereevesrehmanreifreleaserelicremarkableremerremingtonremontistarepeatedlyrepublicrescueresiresimenresinrestorationrestoredresultretailersreticulanretiredreturnedrevealedrevealsreveriereviewreviewingreviewsrex121rhinorickriderridgerietveldrifflerightrikerikyurisen-us-18risen-us-76riserritualriverrk-4061rk-4283rk-4284robertrobinsonrockrockeyerocksteadrogerrogersrollronanroninroosterrootroserosethrosewoodrotoblockroughroxonroxstarrubbedrubbercopperrudolphruplerussellrussiarussianrusskiyrusslockrustedrusticrustyrwl34s-04s-06s-10s-11s-12s-14s-16s-166s-18s-19s-21s-22s-23s-30s-31s-32s110s1661s30vs3140s35vns45vns90vsabersaboteursachsesaddlehornsafetysajisakaisalesallysaloonsalvationsalvosambarsamiersamiorsamusamuraisan-misandsandalsandalwoodsandbarsanderssandlewoodsandstormsanmaesantasantokusantossapphiresapphiressatinsavagesavantsawcutsayasblshikarisc52scabbardscalescalesscallionscarabscaryschoemanschradeschwartzschwarzerscorpionscottscoutscrapsscreamshawscrewscrewsscrimscrimshawscrubberscullsculptedsculptureseahorsesealsealedseanseashellseasonsebenzasecondssecretseedseensekiseki-japanselectselfsellsellersengokusentinalsentinelseptemberserialseriesserratedset-11shabazzshadowshallotshamasshamwarishapesharshardshardbladesharksharpsharpedsharpensharpenersharpeningsharpestsharpnessshavingsshawsheashealthsheatsheathsheath037sheathboxsheathssheepsheepsfootsheetshellshellsshermanshieldshiffershikarishinshinrashipshippingshipsshirasayashirogorovshoeshogunshokuninshootoutshopshortshortsshotshouldshowshredshreddedshunshurapsiberiansiccarisicilysicklesidesidekicksides-damascus-foldingsigilsignaturesignedsilversilverbonesilverdamascussimeonsimonssimplesimplyorn8singhsinglesinkevichsisterssitiviensixleafsizeskeletonskikariskinskinnerskinningskirmishskullskyfallskylinesl-04slabslashsleeperslimslimlineslipslip-jointslipitslipjointsmallsmallestsmithsmkesmokysmoothsnakesnakeskinsnakewoodsnakewoodtitaniumsnipersnowsnubnosesodbustersolesolisolidsolingensolosolsticesomesomethingsongsonssoundsouthsouthernsovietspacespainspaltedspanspanishspartanspearspearpointspecialspeciallyspectacularspectrespeedsafespg2spiderspinespiritsportsspringspringssprintsprucespydercospyderospydiechef-titanium-lc200n-folding-pocket-knife-lsq6078841squeegeesquiresr-1sr-2sr1drsr2dlsr2drsr2drgssctst223st252st401stabstabilizedstablestagstagantlerstagestainlessstainlessg10staminastaminawoodstandstaplerstaplesstarstarozhilstarsstartstationerystauersteaksteamsteelsteelaluminumsteelblacksteelbrasssteelcoppersteelcraftsteelesteelessteelgreensteellotsteelpocketsteelssteeltitaniumsteiersteigerwaltsterilesterkhsterlingstevestevenstianlessstickstidhamstienenstilettostilletostingstingraystitchstockstockingstockmanstonestonesstonewashstonewashedstoneworksstoneworks-mammothstoneworksdamascusstormstormhowlstrastraightstraightbackstrategicstrazh-2streamstreetstrelitstretchstriderstrikestringsstripestripedstrizhstrongstrykerstubbystückstudstuffstuffersstunnerstunningsturgisstylestylesstylishsuchatsuchat-custom-folding-knife-damascus-steel-engraving-black-pearl-dragon-art-k02sullivansultansupersuperbsuperhawksuperlocksupportsurgicalsurprisesurprisessurvsurvivasurvivalsuttonsuwadasvarnsvordswaggerswanswarowskyswayswedenswedishsweetswiftswirlswissswitchswitchbladeswordswordssynergysynergy3syntheticszilaskit-10t-rext12-dpt1810gt1810ht1810it1810jt2026bc1tacticaltacticalgearztacticorixtacticsltactilitytaigatail-locktaiwanesetaketakeritakestakeshitakeshi'chikiri'talentedtalismantalktanbotandytangtanktantotapetarkintarpontaschenmessertaylorsetotb52117tb62110tbfm214teachesteaktechtechniquetechrontecnocuttelltemperedtempesttenabletenderfoottentaratepeterrifyingterrysknifestoreterzuolatesttestingteststexastexasamericantexturedtf4330tf4392-2tf4406thaithailandthanksthemetheorytheretheunsthickthiersthitathomasthompsonthorthornthoththoughtsthrasherthreethujathumbthumbscrewthunderbirdthuyati-cftiblacktiblackbluetibluetibrownticfticoppertidamascustiestigertiger-damasttigerbambootighetigoldtimascustimascusblacktimavotimbertimberwolftimetinkertinustinytipurpletiretirpitztirpitz-damascustishredtishreddedtispintispinetitantitaniumtitaniumblueblacktitaniumcarbontitaniumcftitaniumcoraltitaniumdamascustitaniumg10titaniummicartatitaniumtimascustitimascustitusvilletitwilltiwoodtobintoddtogattatogethertoimintastolerancetomahawktommytonytooltooletoolstoothtoothpicktopaztopotopstorrenttortoistortoisetotallytoucantourismtr-3trackertraditiontraditionaltrailtrailblazertrailingtranquiltransitiontransparenttrapertrappertrapperlocktraveltredbgytredfgytreetreebrandtrendytributetriggertrivisatrollskytrouttroutmantryingts1drts1dsbmts1dsgmtsubatsuchitu-untuckamoretuliptunatungstenturdturenturenzturkeyturkishturnturnbullturningturquoiseturtletusk-bothtuxedotwilighttwilltwisttwistedtwistfulltworowstworowsoftwosunstwosuntwosunknivestwosunstydeustypetyphoonu0026u0026w609u125du126du127dud-0031udaraudk-01udk-f-101uk-699uk-701uk-719ukrainaukraineukrainianultemultimateultraum-4851um-5022um-5049umboxingunboxingunconventionalunfoldunfoldinguniqueunknownunleashedunmatchedunusedunusualupcloseupdateupdatedurbanus-ch-115us-ch-119us-ch-136us-ch-95usa-greenusa-pb-266-busa-pb-267-busa-pb-270-busedussrutilityutopianv6355whva5840cbva5840fcva5944tiva5964tiblva5978fcva5980fcmvagabondvalachovicvalentinevaletvalleyvalvevanhoyvariantvaryag-2vegasvegasmanveinvelociraptorvelvet-linedvendettavernonversesversionvertigoveryvespertiliovg-10vg-10spydvg-10vg-2vg10vg10-c243fpnbdvg10damascusvicarvictorianvictorinoxvideoviewviewsvikingvillersvilliersvintagevioletblueviperviragovisionvivantvividvk0022vk0067vk8136vlogvojkovoorhiesvorsmavoyagervp02vp03vp04vp06vp07vp08vp10vp100vp101vp102vp103vp11vp118vp14vp15vp16vp18vp19vp20vp21vp22vp24vp30vp31vp35vp36vp37vp38vp39vp41vp42vp43vp44vp45vp46vp47vp48vp49vp50vp51vp52vp55vp56vp61vp62vp63vp64vp65vp66vp67vp68vp69vp71vp72vp73vp74vp75vp78vp79vp81vp82vp84vp87vp90vp92vp93vulpisw1759wakizashiwaldenwalkwalkerwalletwalmartwalnutwalruswalterwarenskiwarrenwarriorwashwasherswaterwaterfallwatsonwavewaveswaynewe21016-ds1we21026b-ds1weaponsweaveweberwedgeweekweekenderweidmannsheilweilandweinmuellerweirdestweldedwengewerewesternwesthuizenwestlindwharnciffewharncliffwharncliffewheelerwherewhiplashwhiskerswhitakerwhitewhittakerwhittlerwholesalewidderwifewildwildernesswilliamwilliamswillumsenwilsonwiltonwinewinklerwinstonwinterwinterbladewirewith-linerwith3with325with35with4withbackwithbluewithbonewithbrasswithbronzewithclip-withcustomwithdamascuswithengravedwithfilewithfinewithhwithkerinitewithleatherwithlinerwithlockwithmammothwithnicholswithpocketwithquincewoodwithswithserialwithsheathwithsheathswithstagwithstagewithsteelwithtwithtiwithtrackwithtsheathwizardwolfwomenwoodwood-udk-f-87wood-udk-f-89wood-udk-f-90woodenwoodhornewoodswoollywoolywootzworkworkedworkmanshipworksworkshopworldwormwornwrongwsheathwu-shuwyvernx-seriesxmasxziley-startyagayearyearsyellowyellowhorseyorkyoroiyoshiyoutubeyoutubeshortsyukikazeyvc-10yvc-37z28-damastz5822vz5823vzadirazatorizdp-189zdp189zebrazelanciozermattzerozingzinkerzipperedzirczirconiumzomezorianzt0450cfdamszukuri

Categories

Flickr Photogallery

Subscribe Newsletter

subscribe with FeedBurner

Hand forged Damascus Folding Knife sheep horn engraved bolster

  • January 3, 2021 at 7:37 am
Hand-forged-Damascus-Folding-Knife-sheep-horn-engraved-bolster-01-asyn
Hand forged Damascus Folding Knife sheep horn engraved bolster
Hand forged Damascus Folding Knife sheep horn engraved bolster
Hand forged Damascus Folding Knife sheep horn engraved bolster
Hand forged Damascus Folding Knife sheep horn engraved bolster
Hand forged Damascus Folding Knife sheep horn engraved bolster
Hand forged Damascus Folding Knife sheep horn engraved bolster
Hand forged Damascus Folding Knife sheep horn engraved bolster
Hand forged Damascus Folding Knife sheep horn engraved bolster
Hand forged Damascus Folding Knife sheep horn engraved bolster
Hand forged Damascus Folding Knife sheep horn engraved bolster

Hand forged Damascus Folding Knife sheep horn engraved bolster
Custom Handmade Damascus Beautiful Folding Knife. Blade length : 3 inches. Handle length : 4.5 inches. Hardness: 55 to 60. Sheath: Genuine cow leather. This is our stock photo and we sell many of these knives we do not list the pictures for every single knife. All knives are handmade similar to the stock photo, differences as such as color and patterns of the natural materials used will differ somewhat because these are all natural materials. Every item will be considered as an original because no one knife is ever identical to the other, they are handmade and natural materials are never identical. Damascus History: The Damascus steel blades are reputed to be not only tough but sharp and resilient edge. Damascus steel is placed in layers and heated and fused together by hammering. The steel is folded and this arduous process is repeated until hundreds of layers are achieved. It may be then twisted and reheated and flattened again. This produces patterns in the steel which is stunning in its natural design. The folds that cross the cutting edge, hard then soft, hard then soft, create a saw like serrated, edge. This in addition gives Damascus its sharpness. It’s especially relevant to add Damascus knives, viewed by some to be superior to stainless steel knives. These handmade knives are uniquely made and no one knife is ever like the other, giving each knife it’s original character. Handmade Damascus Folding Knife with Damascus Bolster and Sheep Horn Handle. Knife Care Tips: Care Damascus steel properly to prevent rust. To prevent rust here are some tips; do not store folding knife for long periods in the leather sheath. If you wash the folding knife, do so in warm soapy water. Therefore, do not soak folding knife in water. Wash and dry immediately. Oil or wax the blade to prevent rust also wrap in a soft cloth and store. Wipe excess oil or wax before placing in the leather sheath. For long term storage, store folding knife with the leather sheath, not in it. Do not use oils with silicone in it, as this can cause rust. If rust appears, rub the blade with a metal polish like Brasso or a very fine steel wool, then oil or wax the blade. Wood handles usually benefit from a light coating of furniture wax and a good hand rubbing. In conclusion, some recommended oils and waxes for the protection and lubrication of the blade. Camellia oil, mineral oil, carnauba wax or simple vaseline. While some may rather use other oils and applications, these are safe to use and will not harm you if you were to have residue on the blade while some other applications maybe harmful if consumed. Also, for chef knives, you can simply use cooking oil- no salt. Therefore, never misuse your folding knife. With proper care and usage, your folding knife will last for generations. We would like to take this opportunity and Thank You for your business and welcome your feedback. Hence, if there is anything we can do for you to make your experience better to be the best ever. You are purchasing this knife and understand that you are entirely responsible for the ways you use this knife. Overview: Handmade Damascus Folding Knife Engraved Steel Bolster Sheep Horn Handle Materials; Damascus steel, leather sheath, Damascus knife, hand forged steel, folding knife, Steel Bolster, Engraved steel Bolster, pins, screws, pocket folding knife, gifting knife, compact folding knife, folding knife, engraved knife, use as everyday knife. No hand made knives are made exactly the same. They are custom made originals and may have slight differences. If the item was received broken/ defected it must be reported to us within 24 – 48 hours after receiving your item. Please kindly keep the packaging since we may need pictures to ensure accurate processing of the defect. By purchasing this knife you are acknowledging that you are hereby fully responsible for the ways in which you use this knife. SuperCutlery is in no ways responsible for any misuses or acts with this that may cause injury, harm or death. Never leave knives unattended. The item “Hand forged Damascus Folding Knife sheep horn engraved bolster” is in sale since Sunday, October 22, 2017. This item is in the category “Collectibles\Knives, Swords & Blades\Collectible Folding Knives\Modern Folding Knives\Custom & Handmade”. The seller is “supercutlery” and is located in Valley Stream, New York. This item can be shipped to United States, Canada, United Kingdom, Germany, Brazil, France, Australia, Belgium, Spain, Italy.
  • Brand: SuperCutlery

Hand forged Damascus Folding Knife sheep horn engraved bolster