Tags

-f-14-swordchef-udk-udk-f-105-us-ch-204-us-ch-224-us-f-2010110ivssh01bo222dam01bo223dam01bo297dam01bo739dam1-781-of-a-kind100mm10tipd110084dam110129dam110144dam110190dam110239dam110618dam110dm110th110v111621dam111d112021dam112022dam112116dam112123dam112545dam1132015dam117477dam11tipd12damascus130mm13sn1620damckt162d1660dam1660dambk1660damckt1660dnbb16oz175mm1760dam1776grydam1802gd-bk1812grydam1817gsd-bk1821gsdgn1840damckt1850inch1870oldam1990s19inch1db0072-342-782-blade20-20220mm241-dd-1241-dr-1kp27-32riz3-143-7830-titanium30blade32blade3488d234oz35''damascus35th36damascus36titanium375''396-mck40damascus40pc40th413''damascus440c45''45ozair46''47ozair485-151485-1714blood50ozair51405l525db52ozair535gry-16002cfo6002cfo-11d6002cfo-14d604ds604dst60th6102-12d6102cfo-11d6102cfo-12d6165dam63nf65''6al4v710-144710ds72oz7500dam757-1517suchat7william803k-18805z-8bc80mm816e-28210dmn8210dst8800d-ce8800d-mn8800d-mop8800dcb8800dmn8800dul8pg2908-16195mma03-pa0459a0459clonea5964tiblabaloneaboinaacrylicaf-3africaafricanahadairkatak601alabamaalanalecallenalloyaluminumaluminumwoodamaizingamazingamboinaambooamericanamethystamnaanaxandersonandreandyangledanimalanlteranniversaryannualanodizedansoanthroposantiqueantlerarbolitoarchaeoarchitecharcitechariaarizonaarmyarnoarrivedarrowarthurartisanartsarvenisassistassistedassistedplainassitedatacatz1802gdbkatz1815gdbkauthorizedauthorshipautomaticawesomeaxisayothayaazraelb05-mctbackbacknobackpocketbaconbakedbalbachbalbachdamastbalibalisongballbamboobancheebarkbarlowbarrybarsbasicbasketbassbassmanbatmanbattlebeadbearbearingbeastbeautifulbeggbeltbenchbenchmadebergambernardbestbestechbiker-1biker-2billbillybirchbiriukovbirthdayblackblack-lipblacklipblackwhitebladbladeblade-kb503blade-kb504bladegraybladesblazerbloodbluebluedbnibbo01130bo02574bo03240bo03287bo84damboarbocotebokerbolsterbolsteredbolstersbondbonebonebonebonehornebonehornewoodbonestagbonewoodbonewoodhornbonewoodhorneboomerangbossboughtbovibovinebowiebr0242bradbrandbrassbreakerbrianbridgebrilliantbronzebrownbrowningbuchnerbuckbucknbearbudgetbuffalobullbulldogbulletbumblebunnyburingburlburnleyburntburrbushbushcraftbushibutterflybx-8bx-8ac01cc10jbopc10tipdc113cfpdc11jbopc11tipdc211tipc234-ac41cf40thc90gfblpdca74174cablecabochoncactuscaffreycalycamelcampcampingcanoecanyoncarboncardsmancarriedcarrillocarrilloairkatcartoncarvecarvedcasecenterceramiccertificationchadchainchallengechamblincheburkovcheckeredcheetahchefchesnutchestnutchinachinesechinnockchiselchollachrischubbychuckcitrinecivc907dscivivicladclamclarkclassclassicclassiestclaudeclawclaycleanclear-lake-forgecleavercliffclintclipclip-udk-f-97clip-usclosedcoatedcobaltcobracocobococobolocoffeycoffincoldcollectcollectiblecollectioncollectorcollectorscolorcolorbonehornewoodcoloredcolorfulcolorscombatcontouredcooglercoolcoppercopperheadcoralcorbitcorecoredcoriancorradobillcorsacostumecougarcourtyardcover-udk-usa-188coyotecpm-154craftcraftedcraftsmancraftsmashipcranecrawfordcrestcrimsoncrococrowdercsabacunashircurrycustomcustomedcustomizedcutlerycutwaladaggerdaggers-includingdailydalibordamascusdamascus-mokume-ivory-ctdamascus-steel-bladedamascuscocobolodamascusdamascusdamascusm390damascusmammothdamascussdamascusstagdamascustitaniumdamaskdamastdamasteeldamastmesserdarkdarreldartmouthdaviddaysdealerdecepticon2decepticon2tacticaldeejodeepdelicadeltadeluciadeluxedepotdescriptiondesertdesigndesktopdevildevindiamonddickdickweberknivesdiegodilluviodiplomatdippolddirkdiscontinueddisplaydisplayeddividenddixondkc-101dkc-105dkc-139dkc-169dkc-312dkc-38dkc-45dkc-46dkc-591dkc-592dkc-597dkc-613dkc-614dkc-617dkc-619dkc-62-bldkc-62-wdkc-63dkc-66dkc-67dkc-70dkc-71dkc-72dkc-726dkc-76dkc-783dkc45doctordomastdominatordoubledoucettedozormedragondragonskindreamcatcherdressdropdrop-pointduaneduckdumchusdunkerleydupontdwainedwyerdyeddynastydz-5205-mweagleeasyebayebonyedgeeditionedwardseggerlingeickhornel02delanelementumelephantelevenabeliteembretsenenduraengraveengravedengraverengravingengreavedenlanentireertilestateetchetchedetzlerexcellentexclusiveexoticexpensiveexpoexporterexquisiteexskeliburextremaeyesf-61f-63f-85f-supersonicf011factoryfadedfakefallknivenfancyfangfauxfeatherfecasfeelfiberfieldfiggyfighterfilefile-workfileingfileworkfileworkedfilletfinchfindfinefinishfirefirstfishfishermanfishingfixedfl-002flameflamedflickflightflipperflowerfm214fm215fo-2007fo-2035fo-2081foldfoldefoldedfolderfoldingfoldingpocketfoltsfontenilleforceforestforgeforgedforgingfossilfossilizedfox521dbrfox521dlbfraleyframeframelockfrankfranklinfredfreefreemanfrictionfriezefrontfs13cbc-2fs13cbd-5fs296z-2fs298z-1fs301f-2fs307z-1fs318z-2fs321z-2fs324z-2fs478b-5fukutafullfullyfx-521dlbg-10g10cfgallaghergarnetgategb1039gb1099gb1129gb1160gb1161gb1164gb1179gb1241gb1245gb329gearbestgedraitisgeminigentgentacgentlemangentleman'sgenuinegeorgegermangermanygeweihgiftgilbreathgillgillesglorygodfathergoldgoldengoldscrewgorgeousgorskigottagegradegrapesgrasshoppergraygreatgreengreggrimsmogrindgrindhousegripgripsgrizzlygrooveguardguillochegunshinh300-dhaddockhadehadeshadlehagenhallmarkedhalloweenhammeredhanclehandhand-forgedhandcraftedhandehandelhandlehandleshandmadhandmadehansharaldhardhardnesshardwoodharkinsharringtonhartkopfhaweshawkhdc889heathellionheltonhenryherbertzhermanhh-10176hibbonshideyoshihighhighlyhigohigonokamihikarihindererhirohistoricalhoneyhorizonhornhornbeamhornehornewoodhorsehoundhugehuge1850hummerhunterhunter-factoryhuntershuntinghuntingcampinghuntingcampingfishinghuntingfishinghuntingfoldingbowietrackerkarambithuntinghandmadeleatherhuntsmanimbulaimpactimpressionsinchinchesinclincludeincredibleindiaindianindustryinexpensiveinfernoinlaidinlayinsetintegralinterlockinvestmentirbisironwoodissueitalianitalyitemivoryjackjacksjacksonvillealjadejademanjagdmesserjaguarjamesjangtanonjangtanongjapaesejapanjapanesejaroszjasonjaygerjazzjensjerryjessejewelryjiggedjk-2djnr1035jodyjoeljohnjointjudyjuniperjunkerjunker2juriyk-22k0048k0049k0128chavesk3dpdcfk3tdcfk4blsdkajikalfayankamikanekomakanetsunekarambitkasatkakasperkasumikatakirakatanakatmandukatsukb-504kb508kdm0006ke-f55kellykershawkestrelkeychainkhalsaki3302b1kikyokindkingkiouskiousjuliekirikirinitekirinite-us-ch-06kissingkitchenkizerkizlyarkknivesklappmesseklappmesserkm-102knifeknife'chikiri'knife'doc'knife-dlcknife-japaneseknife-vintageknifedamascusknifehandmadefinishknifehornknifeknivesknifelinerknifemakerknifereadyknifesknifestyleknigeknightknivekniveskniveslockkniveslotknockoutkolourkonrokukriegarkriskubeykukrikungfukusumikwaikenkyoceral21-1056labelladderladyladyalagerlaguiolelancetlapislargelatelaunchlayerlayeredlayerslazulilc22550le801z-2leaderleafleatherleaveleavesleekleftlegacylegionarylengthleninleopardlesnichiyleverlevineleyasulibertylifelightfootlightspeedlillelillielimitedlinerliner-locklinerlocklinerslinklionlionsteellittlelizardlk5015dlmc-1204dloadedlobolocklock-backlockbacklockcs-137lockcs-149lockcs-151lockcs-160lockcs-181lockinglombardlonelonglongworthlooklordlotsloydlozadalst8800dmnlst8800dulluciferlutavoyluvthemknivesm250m390macawmachetemachinemacustamaddmademagnummahoganymahogonymakemakermakersmakhamakingmamamammothmaniagomanualmanufakturmaplemarblemarfionemarkmarkusmarlinmarshalmarshallmartinmassaromastadonmastedonmastermasterpiecemastodonmaterialmaterialsmaxwellmaxxmayomc-0012dmc-0013dmc-0014drmc-0023dmc-0031dmc-0036dmc-0052dmc-0073dmc-0074dmc-0092dmc-0112dmc-0121dmc-0145rmc-0146mc-0161dmc-0164dmc-113dmc-114dmc-121dmc-122drmc-123dmc-125dmc-13dmc-14dmc-15dmc-163dmc-164dmc-16dmc-181dmc-182dmc-183dmc-184dmc-185dmc-18dmc-202mc-25dmc-26dmc-3mc-31dmc-32dmc-33dmc-34dmc-35dmc-36dmc-37cmc-37dmc-53dmc-53drmc-54drmc-71drmc-72dmc-73dmc-74dmc-74drmc-75dmc-76dmc-77dmc-77drmc-78dmc-79dmc0041cmc0161dmc124dmc161dmc163dmccluremcconnellmchenrymcu114dmcu121dmcu122drmcu123dmcu124dmcu12dmcu14dmcu15dmcu161dmcu162dmcu181dmcu183dmcu184dmcu23dmcu31dmcu33dmcu37cmcu41cmcu73dmcu79dmcustamediterraneanmediummelvinmercatormerlinmessermetalmeteoritemexicanmicartamicarta-udk-223michaelmickmicromicrotechmidlandmikemike'whiskers'mikovmilanomillionmillitminiminiatureminibluemintmintyminutesmiragemirrormiyamotomodelmodeledmoellermokimokumemokutimolarmollettamonarchmonkeymonthsmoonmosaicmosiacmostmothermotosukemoverms-167ms-2241ms-3737ms-4901ms-4915muelamullermultimusakamusashimuskratmustmustangmysterynagaonaminapanativenaturalnaturenauticalnavajanavajonbtcsdkrbgnealnecknevernevlingnicenicholsnicknickelnightnini'sninjanironishijinnishjinnoblenobunaganorrisnorthnottnovabladesnowlandnumbernumberednwfcsdkrtgoceanofferoistrichok4foliveolivewoodolsonone-handone-of-a-kindonehandoniononlyopenopeningoperaopnerorangeorianoriginalorthodoxorvisosborneosograndeknivesotter-messeroutdooroutdoorsoverallovereynderoverviewp01bo297damp01bo511damp01bo739dampacificpadaukpaintedpakistanpakkawoodpalmpaperpapersparangpardueparkerparker-edwardsparrotpartpataudpatenpatternpauapaulpb-176pb-178pc38peachpeacockpealpearpearlpeasepeelperalperkinpersianpersistencepeterphilippinesphotospickpiecepiecespikepimppinkpinkdamascuspistolpitbosspk01224pk01227pk01229pk01246pk01253pk01300pk01302pk01305pk01306pk01309pk01310pk01311pk01312pk02132pk02136pk05013pk05014pk05021pk05022pk05023pk05024pk05025pk08009plainplateplatedplatingpocketpocketfoldingpocketknifepohlpointpolishedpondpoosiripoplarpoputchikpouchpowderpowerprattpre-benchmadepredatorpremiumprepperspresentpresentationprestigepricedprimeprincepro-techprocessproductionprotechprotoprototypepullerpumapunisherpurchasepurduepurplepythonqingqualityquestquincequincewoodr1173-dr1303-dr2065r2sg2raindroprainyralphram'sranchrancherrandallrandomrareraskratioravenrazorrea010rea019readyreak4sdrealreateredwoodreesereeverehmanremingtonrescueresinretailersreticulanreviewrhinorickrikerikyurk-4061rk-4283rk-4284robertrockrootroserosewoodrotoblockruplerussellrussiarussianrusskiyrusslockrusticsabersajisalesallysaloonsalvationsambarsamiersamuraisan-misantasantokusapphiresapphiressatinsavagesayascalescalesscallionscarabscaryschradeschwarzerscorpionscoutscrewscrewsscrimshawsculptedsculpturesebenzasecondsseedsekisellserialseriesshabazzshallotsharsharksharpsharpensharpeningsharpestshawshealthsheatsheathsheathssheepsheetshellshipshippingshogunshopshortshowshunshurapsiberiansiccarisidesidekicksigilsignedsilversilverdamascussimonssimplesinghsinglesistersskinskinnerskylineslashslimslipslip-jointsmallsmallestsmithsmoothsnakesnakeskinsnakewoodsnakewoodtitaniumsnowsolesolisolidsolingensolosongsouthsouthernspanspanishspartanspearspearpointspecialspidersportsspringsprintsprucespydercospydiechef-titanium-lc200n-folding-pocket-knife-lsquiresr-1sr-2sr1drsr2drsr2drgssctstabstabilizedstagstagestainlessstaminastaminawoodstarstarozhilstartsteaksteelsteelcraftsteelesteiersteigerwaltsterkhsterlingstevestevenstickstidhamstilettostingraystockstockmanstonestonesstoneworksstormstraightstretchstriderstrykerstubbystückstunningstylesuchatsuchat-custom-folding-knife-damascus-steel-engraving-black-pearl-dragon-art-k02sultansupersuperbsurvivasurvivalswaggerswanswarowskyswedishsweetswiftswirlswissswitchswitchbladeswordsyntheticszilaskit-rext12-dptacticaltactilitytaigatail-locktaketakeritakeshitalismantanbotangtantotarpontaschenmessertbfm214techtechrontecnocuttemperedtempestterrysknifestoreterzuolatesttexturedthaithailandthankstheorythiersthitathomasthompsonthorthornthreethujathumbthumbscrewthuyatigertigerbambootighetimascustimbertimetinkertirpitztispinetitantitaniumtitaniumcarbontitaniumdamascustoddtomahawktommytooltoolstoothtoothpicktopaztopstorrenttortoistortoisetotallytoucantourismtr-3traditiontraditionaltrailtrapertrappertrapperlocktredbgytredfgytreetreebrandtrendytriggertrouttroutmants1drtsuchitulipturkeyturquoiseturtletuxedotwistfulltwosuntyphoonu125du127dud-0031udk-f-101uk-699uk-701uk-719um-4851umboxingunboxinguniqueunusedunusualurbanusa-pb-266-busa-pb-267-busa-pb-270-busedutilityva5840cbva5840fcva5964tiblvalachovicvaletvanhoyvaryag-2vegasvendettaveryvg-10vg10vicarvictorianvictorinoxvideoviewviewsvintagevioletbluevipervk0022vk0067vk8136vlogvojkovorsmavoyagerw1759walkwalkerwalnutwalruswarenskiwarrenwarriorwashwatsonwavewayneweaveweberweilandweinmuellerwharncliffwharncliffewhitakerwhitewholesalewidderwildwilliamwilliamswilsonwiltonwinewinterwith3with325with35with4withbluewithbrasswithbronzewithcustomwithdamascuswithengravedwithfinewithleatherwithlinerwithlockwithpocketwithquincewoodwithserialwithsheathwithstagewolfwoodwoodenwoodhorneworkworkedworkshopworldwornwu-shuy-startyearyearsyellowyellowhorseyoroiyoshizatorizdp-189zermattzingzinkerzipperedzirczirconiumzukuri

Categories

Flickr Photogallery

Subscribe Newsletter

subscribe with FeedBurner

Handmade Folding Knife. Mike'Whiskers' Allen. Damascus Fossil Lockback. Mint

  • November 7, 2019 at 9:52 pm
Handmade-Folding-Knife-Mike-Whiskers-Allen-Damascus-Fossil-Lockback-Mint-01-at
Handmade Folding Knife. Mike'Whiskers' Allen. Damascus Fossil Lockback. Mint
Handmade Folding Knife. Mike'Whiskers' Allen. Damascus Fossil Lockback. Mint
Handmade Folding Knife. Mike'Whiskers' Allen. Damascus Fossil Lockback. Mint
Handmade Folding Knife. Mike'Whiskers' Allen. Damascus Fossil Lockback. Mint
Handmade Folding Knife. Mike'Whiskers' Allen. Damascus Fossil Lockback. Mint
Handmade Folding Knife. Mike'Whiskers' Allen. Damascus Fossil Lockback. Mint
Handmade Folding Knife. Mike'Whiskers' Allen. Damascus Fossil Lockback. Mint
Handmade Folding Knife. Mike'Whiskers' Allen. Damascus Fossil Lockback. Mint
Handmade Folding Knife. Mike'Whiskers' Allen. Damascus Fossil Lockback. Mint
Handmade Folding Knife. Mike'Whiskers' Allen. Damascus Fossil Lockback. Mint
Handmade Folding Knife. Mike'Whiskers' Allen. Damascus Fossil Lockback. Mint
Handmade Folding Knife. Mike'Whiskers' Allen. Damascus Fossil Lockback. Mint

Handmade Folding Knife. Mike'Whiskers' Allen. Damascus Fossil Lockback. Mint
Handmade large (4) lock back folder by Mike’Whiskers’ Allen. Unused and in excellent condition. Damascus blade is tight, centered, and has a powerful opening snap. Not designed to snap closed. Because of it’s design the blade has to be pushed closed against tension when the lock back bar is released. Stainless steel liners and spring bar are file worked all the way around the knife. A portion of the Damascus blade is also file worked. Bolsters are dove tailed Damascus. Scales are smooth polished Mammoth with black liners. Can be opened very quickly when you touch the opening stud releasing the blade tension. Not a scale release but does the same thing as a scale release when you touch the thumb stud. NOT CLASSIFIED AS A SWICHBLADE. Has a lanyard with a little skull on it. His maker’s mark is on the inside on the underside of the back bar. Comes in a padded zippered storage case. St reaks and smudges are fingerprints and polish residue. Shadows and bubbles are from the camera. Ships to 50 states only. The item “Handmade Folding Knife. Mike’Whiskers’ Allen. Damascus Fossil Lockback. Mint” is in sale since Tuesday, November 5, 2019. This item is in the category “Collectibles\Knives, Swords & Blades\Collectible Folding Knives\Modern Folding Knives\Custom & Handmade”. The seller is “gargisse” and is located in Ione, California. This item can be shipped to United States, United Kingdom, Denmark, Romania, Slovakia, Bulgaria, Czech republic, Finland, Hungary, Latvia, Lithuania, Malta, Estonia, Australia, Greece, Portugal, Cyprus, Slovenia, Sweden, South Korea, Taiwan, South africa, Thailand, Belgium, France, Hong Kong, Ireland, Netherlands, Poland, Spain, Italy, Germany, Austria, Bahamas, Israel, Mexico, New Zealand, Philippines, Singapore, Norway, Qatar, Kuwait, Bahrain, Croatia, Malaysia, Colombia, Costa rica, Panama, Trinidad and tobago, Guatemala, Honduras, Brunei darussalam, Iceland, Cambodia, Sri lanka, Luxembourg, Martinique, Pakistan, Uruguay.
  • Modified Item: No
  • Country/Region of Manufacture: United States
  • Blade Material: Damascus Steel
  • Lock Type: Lockback
  • Blade Type: Drop Point
  • Blade Edge: Plain
  • Dexterity: Ambidextrous
  • Type: Pocketknife
  • Year: 1980s – 2000s
  • Number of Blades: 1
  • Opening Mechanism: Manual
  • Handle Material: Mammoth Fossil
  • Brand: Mike ‘Whiskers’
  • Authenticity: Original

Handmade Folding Knife. Mike'Whiskers' Allen. Damascus Fossil Lockback. Mint